BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0874 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16530.1 68418.m01933 auxin efflux carrier family protein con... 30 1.1 At3g03580.1 68416.m00361 pentatricopeptide (PPR) repeat-containi... 28 4.4 >At5g16530.1 68418.m01933 auxin efflux carrier family protein contains auxin efflux carrier domain, Pfam:PF03547 Length = 351 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/78 (24%), Positives = 35/78 (44%) Frame = +1 Query: 337 SSNYCLVIWLDTLDTAPGPLESVISLDMVFGT*EFLFFLVCALGPQCEKIVI*VHWEFHS 516 SSN + +D ++ G E+V+ + F L +L A P C ++ + W F S Sbjct: 160 SSNNISDVQVDNINIESGKRETVVVGEKSFLEVMSLVWLKLATNPNCYSCILGIAWAFIS 219 Query: 517 SLFSYSHVNLIIFKMPTL 570 + S ++N + T+ Sbjct: 220 NRDSGDYINSTPYSEATM 237 >At3g03580.1 68416.m00361 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 882 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 49 GCDGGGEPSVETAADLSMSAMLPDS 123 G G GE ++ET AD+ S ++PDS Sbjct: 586 GMYGEGEKALETFADMEKSGIVPDS 610 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,542,606 Number of Sequences: 28952 Number of extensions: 237601 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -