BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0873 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 61 7e-10 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 61 7e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 56 1e-08 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 54 6e-08 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 54 1e-07 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 53 1e-07 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 53 1e-07 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 53 2e-07 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 53 2e-07 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 51 5e-07 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 49 2e-06 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 46 2e-05 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 44 8e-05 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 44 8e-05 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 44 1e-04 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 44 1e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 42 3e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 42 3e-04 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 41 8e-04 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 40 0.001 At3g03860.1 68416.m00398 expressed protein 36 0.029 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 35 0.038 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 34 0.089 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 33 0.12 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 33 0.12 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 33 0.12 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 33 0.16 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 33 0.21 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.27 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 32 0.36 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 32 0.36 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 31 0.47 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 31 0.63 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 31 0.63 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 31 0.63 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 31 0.63 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.83 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 31 0.83 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 30 1.1 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 30 1.1 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 30 1.1 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 30 1.4 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 30 1.4 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 30 1.4 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 30 1.4 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 29 1.9 At3g14540.1 68416.m01842 terpene synthase/cyclase family protein... 29 1.9 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 1.9 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 29 2.5 At1g79040.1 68414.m09216 photosystem II 10 kDa polypeptide ident... 29 2.5 At1g77250.1 68414.m08997 PHD finger family protein contains Pfam... 29 2.5 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 2.5 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 29 2.5 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 29 3.3 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 29 3.3 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 28 4.4 At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3... 28 4.4 At5g18950.1 68418.m02251 pentatricopeptide (PPR) repeat-containi... 28 5.8 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 28 5.8 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 28 5.8 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 28 5.8 At1g06970.1 68414.m00742 cation/hydrogen exchanger, putative (CH... 28 5.8 At4g19010.1 68417.m02802 4-coumarate--CoA ligase family protein ... 27 7.7 At3g14520.1 68416.m01840 terpene synthase/cyclase family protein... 27 7.7 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 60.9 bits (141), Expect = 7e-10 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 120 DVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEK 242 DVV L DSF+ + K + ALV FYAPWCGHCK++ PE+EK Sbjct: 24 DVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEK 64 Score = 54.8 bits (126), Expect = 4e-08 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 120 DVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 +VV L D+FD I L + + LV FYAPWCGHCK + P +EK AT Sbjct: 142 NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVAT 186 Score = 41.1 bits (92), Expect = 6e-04 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYF---NKGEFKFDAGHARQEDQIISFIKD 433 ++A +DA L ++GV G+PTLK+F NK +D G R D +SFI + Sbjct: 195 VIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGG--RDLDDFVSFINE 247 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +2 Query: 239 KSGHKVKTEKINGILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFK 379 K G K K + ++A VD ++ + +++GV GYPT+++F KG + Sbjct: 64 KLGASFKKAK-SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLE 109 Score = 34.7 bits (76), Expect = 0.051 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 538 KSKHSIVMFYAPWCGHLQK 594 K K ++V FYAPWCGH +K Sbjct: 39 KDKGALVEFYAPWCGHCKK 57 Score = 32.3 bits (70), Expect = 0.27 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGH 585 +F + +++K +V FYAPWCGH Sbjct: 150 NFDEIVLDQNKDVLVEFYAPWCGH 173 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 60.9 bits (141), Expect = 7e-10 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 120 DVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEK 242 DVV L DSF+ + K + ALV FYAPWCGHCK++ PE+EK Sbjct: 24 DVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEK 64 Score = 54.8 bits (126), Expect = 4e-08 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 120 DVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 +VV L D+FD I L + + LV FYAPWCGHCK + P +EK AT Sbjct: 142 NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVAT 186 Score = 41.1 bits (92), Expect = 6e-04 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYF---NKGEFKFDAGHARQEDQIISFIKD 433 ++A +DA L ++GV G+PTLK+F NK +D G R D +SFI + Sbjct: 195 VIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGG--RDLDDFVSFINE 247 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +2 Query: 239 KSGHKVKTEKINGILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFK 379 K G K K + ++A VD ++ + +++GV GYPT+++F KG + Sbjct: 64 KLGASFKKAK-SVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLE 109 Score = 34.7 bits (76), Expect = 0.051 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 538 KSKHSIVMFYAPWCGHLQK 594 K K ++V FYAPWCGH +K Sbjct: 39 KDKGALVEFYAPWCGHCKK 57 Score = 32.3 bits (70), Expect = 0.27 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGH 585 +F + +++K +V FYAPWCGH Sbjct: 150 NFDEIVLDQNKDVLVEFYAPWCGH 173 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.4 bits (130), Expect = 1e-08 Identities = 22/51 (43%), Positives = 32/51 (62%) Frame = +3 Query: 96 DESWARDTDVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 D+ + D V+ L +FD+ ++ + V FYAPWCGHCKR+ PE + AA Sbjct: 25 DDQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAA 75 Score = 28.7 bits (61), Expect = 3.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +1 Query: 556 VMFYAPWCGHLQK 594 V FYAPWCGH ++ Sbjct: 54 VDFYAPWCGHCKR 66 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 54.4 bits (125), Expect = 6e-08 Identities = 20/44 (45%), Positives = 33/44 (75%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 V+ L+ +F ++K + +V FYAPWCGHC+++ PE+EKAA++ Sbjct: 31 VLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEYEKAASE 74 Score = 43.2 bits (97), Expect = 1e-04 Identities = 16/37 (43%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +3 Query: 141 DSFDAILAKA-EHALVVFYAPWCGHCKRIKPEFEKAA 248 +S D I+ K+ ++ L+ FYAPWCGHC+++ P ++ A Sbjct: 380 ESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/30 (56%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 511 LDFQKHTPEKSKHS--IVMFYAPWCGHLQK 594 LD T SKH +V FYAPWCGH QK Sbjct: 34 LDHSNFTETISKHDFIVVEFYAPWCGHCQK 63 Score = 34.3 bits (75), Expect = 0.067 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 535 EKSKHSIVMFYAPWCGHLQK 594 + K+ ++ FYAPWCGH QK Sbjct: 388 KSGKNVLIEFYAPWCGHCQK 407 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 3/53 (5%) Frame = +2 Query: 281 LAAVDATKEP--DLASRFGVKGYPTLKYF-NKGEFKFDAGHARQEDQIISFIK 430 LA +DA++E + A+ + ++G+PTLK N G+ D R+ + I++++K Sbjct: 84 LAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLK 136 Score = 28.3 bits (60), Expect = 4.4 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFN--KGEFKFDAGHARQEDQIISFIK 430 I+A +DAT + F VKG+PT+ YF G G +ED I+F++ Sbjct: 426 IIAKLDATANDIPSDTFDVKGFPTI-YFRSASGNVVVYEGDRTKED-FINFVE 476 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 53.6 bits (123), Expect = 1e-07 Identities = 20/42 (47%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKPEFEKAA 248 V LN +FD ++ +++ +V F+APWCGHCK++ PE++KAA Sbjct: 166 VELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAA 207 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 105 WARDTDVVHLNGDSFDA-ILAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 + + V+ L +F + +L LV F+APWCGHC+ + P +EK A+ Sbjct: 24 YGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVAS 73 Score = 36.3 bits (80), Expect = 0.017 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 281 LAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISF 424 +AA+DA ++ +GV+G+PT+K F G+ D AR I F Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQF 128 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGHLQK 594 +F + E + IV F+APWCGH +K Sbjct: 172 NFDELVTESKELWIVEFFAPWCGHCKK 198 Score = 29.1 bits (62), Expect = 2.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +1 Query: 553 IVMFYAPWCGHLQ 591 +V F+APWCGH Q Sbjct: 50 LVEFFAPWCGHCQ 62 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 53.2 bits (122), Expect = 1e-07 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 V+ L+ +F + K + +V FYAPWCGHCK++ PE+EKAA+ Sbjct: 32 VLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAAS 74 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 39 VEFMRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHC 215 V+ +D P +K + + E+ + V + DS D I L ++ L+ FYAPWCGHC Sbjct: 351 VKDFKDGKIAPHKKSQPIPAEN---NEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHC 407 Query: 216 KRIKPEFEKAA 248 +++ P ++ A Sbjct: 408 QKLAPILDEVA 418 Score = 35.1 bits (77), Expect = 0.038 Identities = 17/54 (31%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +2 Query: 278 ILAAVDATKEP--DLASRFGVKGYPTLKYF-NKGEFKFDAGHARQEDQIISFIK 430 +LA +DA++E + A+++ V+G+PT+K F N G+ + R+ + I++++K Sbjct: 84 VLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLK 137 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 511 LDFQKHTPEKSKHS--IVMFYAPWCGHLQK 594 LD T +KH +V FYAPWCGH ++ Sbjct: 35 LDHTNFTDTINKHDFIVVEFYAPWCGHCKQ 64 Score = 33.1 bits (72), Expect = 0.16 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 544 KHSIVMFYAPWCGHLQK 594 K+ ++ FYAPWCGH QK Sbjct: 393 KNVLLEFYAPWCGHCQK 409 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 53.2 bits (122), Expect = 1e-07 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 V+ L+ +F + K + +V FYAPWCGHCK++ PE+EKAA+ Sbjct: 32 VLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAAS 74 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 39 VEFMRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHC 215 V+ +D P +K + + E+ + V + DS D I L ++ L+ FYAPWCGHC Sbjct: 351 VKDFKDGKIAPHKKSQPIPAEN---NEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHC 407 Query: 216 KRIKPEFEKAA 248 +++ P ++ A Sbjct: 408 QKLAPILDEVA 418 Score = 35.1 bits (77), Expect = 0.038 Identities = 17/54 (31%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +2 Query: 278 ILAAVDATKEP--DLASRFGVKGYPTLKYF-NKGEFKFDAGHARQEDQIISFIK 430 +LA +DA++E + A+++ V+G+PT+K F N G+ + R+ + I++++K Sbjct: 84 VLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLK 137 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 511 LDFQKHTPEKSKHS--IVMFYAPWCGHLQK 594 LD T +KH +V FYAPWCGH ++ Sbjct: 35 LDHTNFTDTINKHDFIVVEFYAPWCGHCKQ 64 Score = 33.1 bits (72), Expect = 0.16 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 544 KHSIVMFYAPWCGHLQK 594 K+ ++ FYAPWCGH QK Sbjct: 393 KNVLLEFYAPWCGHCQK 409 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFN--KGEFKFDAGHARQEDQIISFI 427 ++A +DAT F VKG+PT+ YF G G +ED ISF+ Sbjct: 428 VIAKLDATANDFPKDTFDVKGFPTI-YFKSASGNVVVYEGDRTKED-FISFV 477 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 52.8 bits (121), Expect = 2e-07 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +3 Query: 114 DTDVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 + DVV + +F ++ ++ LV FYAPWCGHC+ + PE+ AAT+ Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAATE 148 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 81 KKDVVDESWARDTDVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 K D + E D DV + GD+FD I L ++ L+ YAPWCGHC+ ++P + K A Sbjct: 431 KSDPIPEK--NDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLA 485 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISFIK 430 +LA +DAT+E +LA + V+G+PTL +F GE K G R ++ I++++K Sbjct: 155 VLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTG-GRTKETIVTWVK 204 Score = 33.5 bits (73), Expect = 0.12 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 535 EKSKHSIVMFYAPWCGHLQ 591 E +++ +V FYAPWCGH Q Sbjct: 118 ENNQYVLVEFYAPWCGHCQ 136 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGHLQ 591 +F + + SK ++ YAPWCGH Q Sbjct: 450 NFDEIVLDDSKDVLLEVYAPWCGHCQ 475 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 52.8 bits (121), Expect = 2e-07 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +3 Query: 114 DTDVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 + DVV + +F ++ ++ LV FYAPWCGHC+ + PE+ AAT+ Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAATE 148 Score = 49.2 bits (112), Expect = 2e-06 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 81 KKDVVDESWARDTDVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 K D + E D DV + GD+FD I L ++ L+ YAPWCGHC+ ++P + K A Sbjct: 431 KSDPIPEK--NDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLA 485 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISFIK 430 +LA +DAT+E +LA + V+G+PTL +F GE K G R ++ I++++K Sbjct: 155 VLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTG-GRTKETIVTWVK 204 Score = 33.5 bits (73), Expect = 0.12 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 535 EKSKHSIVMFYAPWCGHLQ 591 E +++ +V FYAPWCGH Q Sbjct: 118 ENNQYVLVEFYAPWCGHCQ 136 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGHLQ 591 +F + + SK ++ YAPWCGH Q Sbjct: 450 NFDEIVLDDSKDVLLEVYAPWCGHCQ 475 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 51.2 bits (117), Expect = 5e-07 Identities = 19/42 (45%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKPEFEKAA 248 V LN +FD ++ ++ +V F+APWCGHCK++ PE+++AA Sbjct: 165 VELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAA 206 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +3 Query: 87 DVVDESWARDTDVVHLNGDSFDA-ILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 D+ + + VV L +F + +L LV F+APWCGHCK + P +EK A Sbjct: 20 DLSSALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVA 74 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 281 LAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISF 424 +AA+DA A +G+KG+PT+K F G+ D AR I +F Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANF 130 Score = 30.7 bits (66), Expect = 0.83 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 535 EKSKHSIVMFYAPWCGHLQK 594 E ++ IV F+APWCGH +K Sbjct: 178 ESNELWIVEFFAPWCGHCKK 197 Score = 27.5 bits (58), Expect = 7.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 553 IVMFYAPWCGH 585 +V F+APWCGH Sbjct: 52 LVEFFAPWCGH 62 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 49.2 bits (112), Expect = 2e-06 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 114 DTDVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 + DV L D+F + A+V FYAPWCG C+ + PE+ AAT+ Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATE 144 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +3 Query: 81 KKDVVDESWARDTDVVHLNGDSFDAI-LAKAEHALVVFYAPWCGHCKRIKPEFEK 242 K D + E+ D DV + G++FD I L +++ L+ YAPWCGHC+ +P + K Sbjct: 427 KSDPLPEN--NDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWCGHCQSFEPIYNK 479 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/50 (38%), Positives = 33/50 (66%) Frame = +2 Query: 281 LAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISFIK 430 LA +DAT+E DLA ++ ++G+PT+ F GE + R +D I++++K Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLK 200 Score = 31.9 bits (69), Expect = 0.36 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 514 DFQKHTPEKSKHSIVMFYAPWCGHLQKHQ 600 +F + ++SK ++ YAPWCGH Q + Sbjct: 446 NFDEIVLDESKDVLLEIYAPWCGHCQSFE 474 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = +3 Query: 60 VAQPK--QKKKDVVDESWARDTDVVHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKP 230 + QP+ + ++ VV E+ TD+ +N ++D+++ KA +VV F+APWCG CK I P Sbjct: 59 IHQPRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 44.0 bits (99), Expect = 8e-05 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +3 Query: 120 DVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 D V L G +FD + +V FYAPWC C +KP +EKAA Sbjct: 142 DSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAA 184 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKG-EFKFDAGHARQE 406 ILA VD T+E DL R ++GYP+++ F KG + K D H E Sbjct: 200 ILAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDLKDDNAHHDHE 243 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 44.0 bits (99), Expect = 8e-05 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 VV LNGD+ ++ E+ +V+ YAPWC + P F +AAT Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAAT 119 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQII 418 ++A +D + +AS+ +KG+PTL F G + G E+ +I Sbjct: 129 LMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVI 175 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +3 Query: 126 VHLNGDSFDAIL--AKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 V LN +FD++L A++A+V F+A WC C+ KP +EK A Sbjct: 38 VELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +3 Query: 81 KKDVVDESWARDTDVVHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKPEFEKAATK 254 ++ V+ E+ T + +N ++D+++ KA+ + V F+APWCG CK I P + A K Sbjct: 62 RRGVICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQK 120 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.9 bits (94), Expect = 3e-04 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +3 Query: 120 DVVHLNGDSFDAIL--AKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 + + LN +FD++ + A++A++ F+A WC C+ KP +EK A Sbjct: 42 NAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.9 bits (94), Expect = 3e-04 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +3 Query: 120 DVVHLNGDSFDAIL--AKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 + + LN +FD++ + A++A++ F+A WC C+ KP +EK A Sbjct: 42 NAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAAT 251 V+ LNGD ++ E +V+ YAPWC + P F +AAT Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAAT 121 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQII 418 ++A +D + +AS +KG+PTL F G G + ED +I Sbjct: 131 LMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVI 177 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKG-EFKFDAGHARQE 406 +L VD T+EP L R ++GYP+++ F KG + + D GH E Sbjct: 200 LLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHE 243 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 + L SF+A+ +V F APWC R+KP +EKAA Sbjct: 144 IPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWEKAA 184 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 35.5 bits (78), Expect = 0.029 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +3 Query: 117 TDVVHLNGDSFDAILAKAE---HALVVFYAPWCGHCKRIKPEFE 239 T + ++GDS D ++A + V+FYA WC + ++P+F+ Sbjct: 54 TPPIEVDGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFD 97 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 35.1 bits (77), Expect = 0.038 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 + L G +F+ + +V FYAPWC R+KP + KA+ Sbjct: 145 IPLTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185 Score = 34.7 bits (76), Expect = 0.051 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 278 ILAAVDATKEPDLASRFGVKGYPTLKYFNKGE-FKFDAGHARQE 406 +L +VD T+EP L ++GYP+++ F +G + D G+ E Sbjct: 201 LLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHE 244 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 33.9 bits (74), Expect = 0.089 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVF--YAPWCGHCKRIKPEFEKAATK 254 V ++ D+F I+ A LVV Y WCG CK I P+++ + K Sbjct: 70 VTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEK 115 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 123 VVHLNGDSFDAILAKAEHALVVF--YAPWCGHCKRIKPEFEKAATK 254 V ++ D+F I+ A +VV Y WCG CK I P++++ + K Sbjct: 80 VTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEK 125 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +3 Query: 120 DVVHLNGDSFDAILA---KAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 +VV+L+ + ++ + E +VV YAPWC C+ ++ F++ A K Sbjct: 347 NVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 156 ILAKAEHALVVFYAPWCGHCKRIKPEFE 239 +L A+ LV F A WCG CK I P E Sbjct: 83 VLESAQPVLVEFVATWCGPCKLIYPAME 110 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 33.1 bits (72), Expect = 0.16 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 99 ESWARDTDVVHLNGDSFDA-ILAKAEHALVVFYAPWCGHCKRIKPEFEKAA 248 ++ A +V +L+ + +L LV F+APWCG C+ I P ++ A Sbjct: 80 DTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLA 130 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 290 VDATKEPDLASRFGVKGYPTLKYFNKGEFK 379 ++ + P+ A+R+G++ PT+ F GE K Sbjct: 142 INTDESPNTANRYGIRSVPTVIIFKGGEKK 171 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 32.7 bits (71), Expect = 0.21 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 180 LVVFYAPWCGHCKRIKPEFEKAATK 254 ++ F A WCG CK ++P+ E+ A K Sbjct: 63 VIEFTAKWCGPCKTLEPKLEELAAK 87 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 141 DSFDAILAKAEHALVV-FYAPWCGHCKRIKP 230 +SFD +L ++ ++V FYA WCG C+ + P Sbjct: 66 NSFDDLLQNSDKPVLVDFYATWCGPCQLMVP 96 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 31.9 bits (69), Expect = 0.36 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 165 KAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 + E +VV YAPWC C+ ++ +++ A K Sbjct: 372 RKEPWIVVLYAPWCPFCQAMEASYDELADK 401 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 147 FDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 FD++ + ++ F A WCG CK ++P + A+K Sbjct: 36 FDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASK 71 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 31.5 bits (68), Expect = 0.47 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 141 DSFDAILAKAEHALVV-FYAPWCGHCKRIKP 230 DSF+ +L ++ ++V +YA WCG C+ + P Sbjct: 71 DSFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +3 Query: 138 GDS-FDAILAKA----EHALVVFYAPWCGHCKRIKPEFEKAATK 254 G+S FD ++ A E ++V+ A WC C +KP+ EK A + Sbjct: 83 GESHFDQVMEDAQKLGESVVIVWMAAWCRKCIYLKPKLEKLAAE 126 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 120 DVVHLNGDSF-DAILAKAEHALVVFYAPWCGHCKRI 224 +V+ L ++F D I K V F PWC HCK++ Sbjct: 26 EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 120 DVVHLNGDSF-DAILAKAEHALVVFYAPWCGHCKRI 224 +V+ L ++F D I K V F PWC HCK++ Sbjct: 26 EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 120 DVVHLNGDSF-DAILAKAEHALVVFYAPWCGHCKRI 224 +V+ L ++F D I K V F PWC HCK++ Sbjct: 26 EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.83 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 165 KAEHALVVFYAPWCGHCKRIKPEFE 239 K ++A ++FYA WC + ++P F+ Sbjct: 73 KCDYAALLFYASWCPFSRLVRPSFD 97 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 30.7 bits (66), Expect = 0.83 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 165 KAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 + E LVV YAPWC C+ ++ + + A K Sbjct: 361 RKEAWLVVLYAPWCPFCQAMEASYIELAEK 390 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKPEFEKAATK 254 +H + A+ E ++V FY WC C+ + P+ K A + Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 126 VHLNGDSFDAILAKAEHALVV-FYAPWCGHCKRIKPEFEKAATK 254 +H + A+ E ++V FY WC C+ + P+ K A + Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVE 151 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 111 RDTDVVHLNGDSF-DAILAKAEHALVVFYAPWCGHCKRI 224 RD+ + S+ D++L LV FY WCG C+ + Sbjct: 64 RDSRAAEVTQRSWEDSVLKSETPVLVEFYTSWCGPCRMV 102 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +3 Query: 135 NGDSFDAILAKAEHA----LVVFYAPWCGHCKRIKPEFEKAATK 254 N + DA+L+ A ++ + A WC C +KP+ EK A + Sbjct: 103 NVEELDAVLSHARQLSQPIIIEWMASWCRKCIYLKPKLEKLAAE 146 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 147 FDAILAKAEHALVVFYAPWCGHCKRIKPEFEK 242 ++ L+ + +V FYA WC C+ + P+ K Sbjct: 131 YEEALSNGKPTVVEFYADWCEVCRELAPDVYK 162 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 150 DAILAKAEHALVVFYAPWCGHCKRIKPEFEK 242 D I + A++ + A WCG C +I P F K Sbjct: 37 DDIKSSKSPAVINYGASWCGVCSQILPAFRK 67 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 165 KAEHALVVFY-APWCGHCKRIKPEFEKAATK 254 KA L++++ A WCG C+ + P + AT+ Sbjct: 290 KASRLLILYFTATWCGPCRYMSPLYSNLATQ 320 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 29.5 bits (63), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 195 APWCGHCKRIKPEFEKAATK 254 APWC CK+I+P F A++ Sbjct: 17 APWCVPCKKIEPVFRDLASR 36 >At3g14540.1 68416.m01842 terpene synthase/cyclase family protein similar to terpene synthase GB:CAA72074 from [Arabidopsis thaliana] Length = 602 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 21 NKRQAIVEFMRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSFDAILAKAEHALVVFY 194 NK+ + EFM P+Q ++ +AR DV++ GD + K EH + Y Sbjct: 540 NKKVVVEEFMNSHDRVPRQVLLRCLN--FARLFDVIYTEGDGYSEPKGKIEHFMTSLY 595 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = +3 Query: 126 VHL--NGDSFDAILAKAEH--ALVV--FYAPWCGHCKRIKPEFEKAATK 254 VHL +S+D LA+A+ +VV F A WCG CK + P F + + K Sbjct: 25 VHLITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEK 73 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 147 FDAILAKAEHALVVFYAPWCGHCKRIKPEFEKAATK 254 F+ I + +V F A WCG C+ I+P A K Sbjct: 40 FNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADK 75 >At1g79040.1 68414.m09216 photosystem II 10 kDa polypeptide identical to photosystem II 10 kDa polypeptide, chloroplast [precursor] SP:P27202 from [Arabidopsis thaliana]; contains Pfam profile: PF04725 photosystem II 10 kDa polypeptide PsbR Length = 140 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 251 KVKTEKINGILAAVDATKEPDLASRFGVKGYPTLKYFNK 367 K+KT+K GI ++D D + R G KGY KY +K Sbjct: 46 KIKTDKPFGINGSMDLRDGVDASGRKG-KGYGVYKYVDK 83 >At1g77250.1 68414.m08997 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 522 Score = 29.1 bits (62), Expect = 2.5 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = +1 Query: 178 HWSYSTRPGVDTANVLNQSSKKRPQSKD*KD*RNISSCRCYKGARFSVEIWCQGISDSE 354 +WS ++AN ++ SKK K K R+ S+ +C + RFS+E G+S SE Sbjct: 29 NWSAGCGAMANSANASSRDSKKIQTYKRRKLGRSYSANKCSENDRFSME----GVSHSE 83 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 162 AKAEHALVVFYAPWCGHCKRIKPEFEK 242 ++ H +V+F A WCG C+ + P K Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIPILNK 251 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 96 DESWARDT-DVVHLNGDSFDAILAKAEHALVVFYAPWCGHCKRIKPEFE 239 DE W + D++H N K ++ ++FYA WC + +P F+ Sbjct: 65 DERWLQIALDMIHKN---------KCDYVALLFYASWCPFSRSFRPSFD 104 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 284 AAVDATKEPDLASRFGVKGYPTLKYFNKGEFKFDAGHARQEDQIISFIKD 433 A +++ +P S++GV G+PTL N + R D +++F D Sbjct: 117 AIKESSIKPSTLSKYGVHGFPTLLLLN-STMRARYRGTRMLDSLVAFYSD 165 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 180 LVVFYAPWCGHCKRIKPEFEKAA 248 +V FY WCG C+ + P+ K A Sbjct: 117 IVDFYGTWCGSCRAMFPKLCKTA 139 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = +3 Query: 111 RDTDVVHLNGDSFDAILAKAEHALV--VFY--APWCGHCKRIKPEFEKAATK 254 R + VV + F++ L+KA + VFY A WCG C+ I P + + K Sbjct: 48 RSSFVVLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNK 99 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 150 DAILAKAEHALVV-FYAPWCGHCKRIKPE 233 D++L + +V+ FY+P CG CK + P+ Sbjct: 98 DSLLNAGDRLVVLDFYSPGCGGCKSLHPK 126 >At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3.1) (GLR2) identical to putative glutamate receptor GLR2 [Arabidopsis thaliana] gi|4185740|gb|AAD09174; plant glutamate receptor family, PMID:11379626 Length = 951 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +2 Query: 164 KGGTRTGRILRALVWTLQTY*TRVRKSGHKVKTEKINGILA----AVDATKEPDLASRF 328 K R G + + VW T+ + V S + T+ +NG+L D+ K+ D A+R+ Sbjct: 270 KEAERLGMMEKGYVWIATTWLSSVLDSNLPLDTKLVNGVLTLRLHTPDSRKKRDFAARW 328 >At5g18950.1 68418.m02251 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 483 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 512 STFRNTLRKNPNTALSCSTRHGAATCKSTKPD 607 S FRN RKNPNT + T + C+S KPD Sbjct: 10 SFFRNRTRKNPNTQIRSLTVE-SRDCES-KPD 39 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 180 LVVFYAPWCGHCKRIKPEFEKAATK 254 +V F A WCG C+ I P F A K Sbjct: 32 VVDFTASWCGPCRFIAPFFADLAKK 56 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 180 LVVFYAPWCGHCKRIKPEFEKAATK 254 +V FYA WCG C + E E A + Sbjct: 98 IVDFYATWCGPCILMAQELEMLAVE 122 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 180 LVVFYAPWCGHCKRIKPEFEKAATK 254 +V F++P CG CK + P+ K A K Sbjct: 117 VVDFFSPSCGGCKALHPKICKIAEK 141 >At1g06970.1 68414.m00742 cation/hydrogen exchanger, putative (CHX14) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 829 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +3 Query: 36 IVEFMRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSFDAILAKAEHAL 182 I +F +++PK ++ + T V+ GDSFD ++ +H L Sbjct: 698 INDFKNFAMSKPKISYREEIVRDGVETTQVISSLGDSFDLVVVGRDHDL 746 >At4g19010.1 68417.m02802 4-coumarate--CoA ligase family protein / 4-coumaroyl-CoA synthase family protein similar to 4CL from Pinus taeda, gi:515503, gi:1143308; contains Pfam AMP-binding enzyme domain PF00501 Length = 566 Score = 27.5 bits (58), Expect = 7.7 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 48 MRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSF 149 M+ + PK + +V++SW R D+ + + D + Sbjct: 418 MKGYLNNPKATQMSIVEDSWLRTGDIAYFDEDGY 451 >At3g14520.1 68416.m01840 terpene synthase/cyclase family protein similar to terpene synthase GB:CAA72074 from [Arabidopsis thaliana] Length = 605 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 21 NKRQAIVEFMRDPVAQPKQKKKDVVDESWARDTDVVHLNGDSFDAILAKAEHALVVFY 194 NK+ + EFM P+Q ++ +AR DV++ GD + K EH + Y Sbjct: 543 NKKVVMEEFMNSHDHVPRQVLLRCLN--FARLFDVMYTEGDGYSEPKGKIEHFMTSLY 598 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,839,889 Number of Sequences: 28952 Number of extensions: 234556 Number of successful extensions: 842 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -