BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0872 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.7 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 276 VLASNIPPVKLMFLYSTVSTLKPIVGIVVTISPNLS 169 + AS+I ++FL + ++ I G+ SPNL+ Sbjct: 805 IYASSIDKENILFLDLSTGKVEMITGVGKATSPNLT 840 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = +3 Query: 204 LLALMWRQ*NTKTLVLLVGCWR---PRQN 281 +L L W + N ++ L+G WR PR N Sbjct: 1208 VLTLAWSESNVESKGRLLGFWRVEMPRSN 1236 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 259 DVGGQDKIRPLWRH 300 DV DK+ PL+ H Sbjct: 267 DVSSNDKVHPLYGH 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,811 Number of Sequences: 438 Number of extensions: 4456 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -