BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0869 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2113| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53911| Best HMM Match : Ald_Xan_dh_C2 (HMM E-Value=0) 28 7.2 >SB_2113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 67 SSGQWEVVGKNKKSQNGKLKSKEDEKKALKNGPKLE 174 S+G+WEVVGK K + K K EK + + PKL+ Sbjct: 15 SAGKWEVVGKGGKKRQHNDKKK--EKFSSADAPKLD 48 >SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 873 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 453 IYPATYPLSETPDELKRTLQVFFKMLERQMCSYSLMALLQ 572 I T ++E PD + R ++ FK L+ +CS + +L++ Sbjct: 559 IRQVTCVINELPDSVNRVMKYLFKFLKHSICSLNARSLVK 598 >SB_53911| Best HMM Match : Ald_Xan_dh_C2 (HMM E-Value=0) Length = 817 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +1 Query: 598 STCPWSQITASDASSRITPSFVLHPSRSMEV*NSYRIDPYRNVSTVGIWTRW 753 +T P S TA+ AS+ I VL+ + RI+PY+ + G W W Sbjct: 570 NTVPNSSPTAASASTDIYGMAVLNACEKIV----RRIEPYKKANPKGTWNDW 617 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,845,015 Number of Sequences: 59808 Number of extensions: 359631 Number of successful extensions: 919 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -