BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0868 (678 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 58 3e-07 UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; ... 50 7e-05 UniRef50_UPI00006CE956 Cluster: Eukaryotic aspartyl protease fam... 35 1.6 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 57.6 bits (133), Expect = 3e-07 Identities = 31/62 (50%), Positives = 36/62 (58%) Frame = -3 Query: 622 VFFYIILVDPADFVVPPIDK*KT*TLVXXXXXXXXXXXXTGDTSREKKNCHFY*IPSIFI 443 + F IIL DPADFVVP + L TGDTS+EK+NC+FY IP IFI Sbjct: 16 ILFMIILADPADFVVPQSINKRPKHLYKINLKQTKGIRQTGDTSKEKQNCYFYLIPRIFI 75 Query: 442 FI 437 FI Sbjct: 76 FI 77 >UniRef50_Q86QT4 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 47 Score = 49.6 bits (113), Expect = 7e-05 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +3 Query: 354 LKLENGWTDLANFGLELFVEVQRRFK 431 LKLENGWTDLANFGLEL VEVQR K Sbjct: 20 LKLENGWTDLANFGLELPVEVQRGLK 45 >UniRef50_UPI00006CE956 Cluster: Eukaryotic aspartyl protease family protein; n=1; Tetrahymena thermophila SB210|Rep: Eukaryotic aspartyl protease family protein - Tetrahymena thermophila SB210 Length = 550 Score = 35.1 bits (77), Expect = 1.6 Identities = 23/95 (24%), Positives = 40/95 (42%) Frame = -3 Query: 391 KLAKSVQPFSSFSETNEQQFIFI*YSQNRLLRPRLEQHTGYNNLEQGPG*MPYDRLIKNI 212 K+ ++ F++ E + I I R+ P+L H NLEQG P + K Sbjct: 2 KVLFAIFTFATILEVYAAELIKIPLQAVRIEEPKLSNHAYMRNLEQGS--TPKQQFSKQS 59 Query: 211 AFYDIGNNDIPHKTTTFN*YFGELDMLERLAQLYC 107 + Y +G I + +F+ F + + +YC Sbjct: 60 SLYYVGTVKIGSQEQSFSLLFDTTTSISWIPSVYC 94 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,446,823 Number of Sequences: 1657284 Number of extensions: 11680531 Number of successful extensions: 21463 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21455 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -