BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0868 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_18800| Best HMM Match : Cytomega_UL20A (HMM E-Value=7.7) 28 8.0 >SB_44455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = -3 Query: 352 ETNEQQFIFI*YSQNRLLRPRLEQHTGYNNLEQGPG*MPYDRLIKNIAFYDIGNNDIP 179 E NE+ + L+RPRL GYNN + Y L++NI I D P Sbjct: 396 EYNEKALFKVGRGNRVLMRPRLAAGIGYNNRRLSDPGLFYPTLLENIVIRGILPPDYP 453 >SB_18800| Best HMM Match : Cytomega_UL20A (HMM E-Value=7.7) Length = 140 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 413 SPEKVQKVDKYENARNLIKMTIFFLP*CVPRRRISFVCFRV-ILYQSLGLLFIDWGHYKV 589 S +KV K+D+ E RN KM FL PR + R + +++ + ++W ++V Sbjct: 54 SKKKVDKLDEMEKLRNSEKMMDAFLASTAPRTHETDKSERTKTIIKTIRVSDVNWIDWQV 113 Query: 590 CRVN 601 VN Sbjct: 114 SDVN 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,673,415 Number of Sequences: 59808 Number of extensions: 353749 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -