BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0868 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75529-8|CAA99788.2| 350|Caenorhabditis elegans Hypothetical pr... 29 4.0 AL117207-5|CAB60395.1| 375|Caenorhabditis elegans Hypothetical ... 29 4.0 >Z75529-8|CAA99788.2| 350|Caenorhabditis elegans Hypothetical protein C44H9.8 protein. Length = 350 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 512 ISFVCFRVILYQSLGLLFIDWGHYKVCRVN*YNIKKD 622 I V R + Y++ +D+ H+ V RVN Y+ +KD Sbjct: 22 IGKVIMRSLAYETCDKASLDFNHHSVVRVNCYDQQKD 58 >AL117207-5|CAB60395.1| 375|Caenorhabditis elegans Hypothetical protein Y60A3A.7 protein. Length = 375 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 451 CSEFNKNDNFFSPLMCPPSAD 513 C N D++FSP+ C P+AD Sbjct: 307 CVTLNSYDDYFSPIECIPTAD 327 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,329,831 Number of Sequences: 27780 Number of extensions: 290137 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -