BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0867 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 1e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 59 3e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 54 9e-08 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 51 8e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 6e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 44 9e-05 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 37 0.019 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 34 0.099 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 31 0.92 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 30 1.6 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 2.1 SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) 29 2.8 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 29 2.8 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 29 2.8 SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 3.7 SB_41425| Best HMM Match : DCX (HMM E-Value=8.6e-06) 29 4.9 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 28 8.6 SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) 28 8.6 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 77.0 bits (181), Expect = 1e-14 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 4/143 (2%) Frame = +2 Query: 260 QPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKT 439 +PFNKNFY+ HP + K+S E+++ R + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 440 MGYKEPTPIQAQGWPIAMSGKNLLAYPK----RVPAKRWPTSCQPLCT*TTNRLFGEVMV 607 + Y +PT IQ Q PIA+SG++++ K + A WP + G+ + Sbjct: 535 LEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMD--QPELQVGDGPI 592 Query: 608 RLLWSLAPTRELAQPXSASCCRF 676 L+ APTREL Q RF Sbjct: 593 VLI--CAPTRELCQQIYTEARRF 613 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 63.3 bits (147), Expect = 2e-10 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 4/107 (3%) Frame = +2 Query: 260 QPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVK 436 QPF K+FY P + K +P E +E+R + E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 437 TMGYKEPTPIQAQGWPIAMSGKNLLAY---PKRVPAKRWPTSCQPLC 568 Y++PTPIQAQ P+ MSG++++A P R A + C+ C Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFC 168 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +2 Query: 308 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 475 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +1 Query: 547 YILPAIVHINXQPPIRRGDGPIALVFGAYQRVSTTXFRKLLQILDTHLMVRNTC 708 +ILP IVHIN QP ++ GDGPI LV R +++ + H +R+TC Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVL-CPTRELAQQVQEVAYSVGKHCKLRSTC 165 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/91 (29%), Positives = 48/91 (52%) Frame = +2 Query: 281 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 460 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 461 PIQAQGWPIAMSGKNLLAYPKRVPAKRWPTS 553 PIQ Q P+ +SG++++ K P+S Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGSGKLLPSS 251 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 54.4 bits (125), Expect = 9e-08 Identities = 38/131 (29%), Positives = 61/131 (46%), Gaps = 3/131 (2%) Frame = +2 Query: 266 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 445 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 446 YKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPLCT*TTNRL---FGEVMVRLL 616 ++ PTPIQ Q MSG++++ + K S PLC + G+ V L+ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSL-PLCMLLRTKAPSNPGDTPVALI 150 Query: 617 WSLAPTRELAQ 649 L PTREL Q Sbjct: 151 --LTPTRELMQ 159 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/61 (36%), Positives = 36/61 (59%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQPPIRRGDGPIALVFGAYQRVSTTXFRKLLQIL 678 ++ IG+ +TGSGKTLAY LP + + + P GD P+AL+ + + F + ++L Sbjct: 110 RDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQVFMNVSEML 169 Query: 679 D 681 D Sbjct: 170 D 170 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 52.0 bits (119), Expect = 5e-07 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 4/104 (3%) Frame = +2 Query: 347 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPK- 523 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++A + Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 757 Query: 524 ---RVPAKRWPTSCQPLCT*TTNRLFGEVMVRLLWSLAPTRELA 646 + A P + T+ F E +APTRELA Sbjct: 758 GSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELA 801 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/60 (33%), Positives = 37/60 (61%) Frame = +2 Query: 332 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLL 511 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQPPIRRGD----GPIALVFGAYQRVSTTXFRKL 666 ++ IGV +TGSGKT A+ +P +V I P I R + GP AL+ + ++ ++ Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEI 198 Query: 667 LQ 672 L+ Sbjct: 199 LK 200 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +2 Query: 320 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 487 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 488 AMSG 499 G Sbjct: 197 MAHG 200 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.0 bits (109), Expect = 8e-06 Identities = 32/110 (29%), Positives = 46/110 (41%) Frame = +2 Query: 356 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPKRVPA 535 VSG I F E F + + + GY+ PTP+Q PI M+G++L+A + Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 536 KRWPTSCQPLCT*TTNRLFGEVMVRLLWSLAPTRELAQPXSASCCRFWTH 685 K L + L L +APTRELA+ +F H Sbjct: 529 KTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDH 578 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.4 bits (100), Expect = 9e-05 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = +2 Query: 347 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++A Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMA 176 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 1/100 (1%) Frame = +2 Query: 392 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPLCT 571 FE+ + G+ G+ +P+PIQ + P+A++G+++LA K K PL Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKT-AAYLVPLLE 107 Query: 572 *T-TNRLFGEVMVRLLWSLAPTRELAQPXSASCCRFWTHI 688 T T + + +V L PTRELA S C H+ Sbjct: 108 RTDTTKNCIQALV-----LVPTRELALQTSQICIELGKHM 142 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 1/100 (1%) Frame = +2 Query: 392 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPLCT 571 FE+ + G+ G+ +P+PIQ + P+A++G+++LA K K PL Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKT-AAYLVPLLE 107 Query: 572 *T-TNRLFGEVMVRLLWSLAPTRELAQPXSASCCRFWTHI 688 T T + + +V L PTRELA S C H+ Sbjct: 108 RTDTTKNCIQALV-----LVPTRELALQTSQICIELGKHM 142 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/63 (33%), Positives = 35/63 (55%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQPPIRRGDGPIALVFGAYQRVSTTXFRKLLQIL 678 ++ +G KTGSGKTLA+++P I+ + DG ALV + ++ F L++I Sbjct: 88 RDVLGAAKTGSGKTLAFLIP-IIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIG 146 Query: 679 DTH 687 + H Sbjct: 147 NKH 149 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 383 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPK 523 ++ F + G+ G+ PT IQ QG P+A+SG+++L K Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAK 95 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 35.1 bits (77), Expect = 0.057 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 433 KDNGLQRTDAHSSSRLADSYVWKEFIGVPKTGSGKTLAYILPAI-VHINXQPPIRRGDGP 609 KD G +A ++ +G KTGSGKTLA+++P + + Q R G G Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGV 647 Query: 610 IAL 618 I + Sbjct: 648 III 650 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 34.3 bits (75), Expect = 0.099 Identities = 24/74 (32%), Positives = 35/74 (47%) Frame = +2 Query: 425 QGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPLCT*TTNRLFGEVM 604 + V +G+ PTPIQA P+A+ GK++ A K P+ R Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKT-AAFMLPILERLLYRPTQSPA 81 Query: 605 VRLLWSLAPTRELA 646 +R+L + PTRELA Sbjct: 82 IRVL-VITPTRELA 94 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 34.3 bits (75), Expect = 0.099 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 383 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 I FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQPP 588 ++ + +TGSGKT A+++P + I + P Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRIYMEGP 942 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 34.3 bits (75), Expect = 0.099 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 436 DNGLQRTDAHSSSRLADSYVW-KEFIGVPKTGSGKTLAYILPAIVHI 573 D G + S + + ++ ++ IG +TGSGKTLA+ +P I HI Sbjct: 147 DQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQHI 193 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 31.1 bits (67), Expect = 0.92 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 433 KDNGLQRTDAHSSSRLADSYVWKEFIGVPKTGSGKTLAYILPAIVHI-NXQPPIRRGDGP 609 +D G+ +S Y ++ IG +TG+GKTL++ LP + + + + +RG P Sbjct: 89 EDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAP 148 Query: 610 IALV 621 LV Sbjct: 149 KVLV 152 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 368 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 481 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQP 585 ++ IG KTGSGKT A+ LP + + P Sbjct: 45 RDCIGCAKTGSGKTAAFALPILQKLCDDP 73 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 278 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 418 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) Length = 493 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -3 Query: 171 YCHRCQIEKNYRRICCLL----QIWNHRFHGYYSSYQT*LFF 58 +CHR Q NY C ++ Q+W+H + SS ++ +F+ Sbjct: 178 FCHRQQYRHNYYNSCLVITFFRQMWDHLWANVGSSVESSVFY 219 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQP 585 K+ IG+ +TGSGKT A+ LP + + P Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNP 30 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHINXQPPIRR---GDGPIALV 621 ++ GV GSGK LAY+LP I I + +GP+ L+ Sbjct: 225 RDVAGVAIEGSGKRLAYLLPIIHQITESSVYQELPLANGPLVLI 268 >SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 505 FIGVPKTGSGKTLAYILPAIV 567 F+ +P TGSGK+L Y LPA+V Sbjct: 38 FVSMP-TGSGKSLCYQLPAVV 57 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 344 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 496 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_41425| Best HMM Match : DCX (HMM E-Value=8.6e-06) Length = 1098 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +2 Query: 407 FPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPL 565 +P+ + K G KE P AQ W I SG L Y K +P S +PL Sbjct: 684 YPEVSLEVKKKKGSKEVWPSDAQMWVITQSG---LIYSKAMPQLALTRSERPL 733 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 520 KTGSGKTLAYILPAIVHINXQPPIRRG 600 +TGSGKTLAY+ P +VH + R G Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHG 448 >SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) Length = 321 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +2 Query: 443 GYKEPTPIQAQGWPIAMSGKNLLAYPKRVPAKRWPTSCQPLC 568 G P+ G P+ SG P + A P+SCQP C Sbjct: 152 GPASPSFGSVYGAPVQFSGMPSQCAPSCMAASPCPSSCQPTC 193 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILP 558 K+ + + +TGSGKT A+++P Sbjct: 319 KDVVAMARTGSGKTAAFLIP 338 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,367,930 Number of Sequences: 59808 Number of extensions: 464643 Number of successful extensions: 1206 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1194 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -