BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0867 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 42 2e-05 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 27 0.58 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 1.8 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.3 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 4.1 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 24 4.1 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 5.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 9.5 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 41.9 bits (94), Expect = 2e-05 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +2 Query: 347 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L+A Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMA 216 Score = 29.5 bits (63), Expect = 0.11 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 499 KEFIGVPKTGSGKTLAYILPAIVHI 573 ++ + +TGSGKT A++LP I H+ Sbjct: 212 RDLMACAQTGSGKTAAFMLPMIHHL 236 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 27.1 bits (57), Expect = 0.58 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 100 TVVPNLEEATNSAIILLDLATVAIDLEDLEDLVGKKNSLE 219 T++ +L+E S + LDL ID +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.4 bits (53), Expect = 1.8 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = -3 Query: 276 FLLKGWSEQNPNL---GDACSDLQRILF----SHQILQILQIYCH 163 F+ KG E +PN GDA D++ +LF S +I +Q CH Sbjct: 926 FVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 149 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 9 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 24.2 bits (50), Expect = 4.1 Identities = 16/70 (22%), Positives = 26/70 (37%) Frame = +2 Query: 221 SEHASPRLGFCSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEE 400 SE + +++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 401 ANFPDYVQQG 430 A Y G Sbjct: 157 AQIDVYHVDG 166 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -3 Query: 702 VTNHKMCVQNLQQLAEXGCANSLVGAKDQSNRTITSPNRRLVVYVH 565 +TN MC + ++ E C +S+VG +T+ R+V ++H Sbjct: 306 ITN--MCTMSYEE-EEEHCHDSIVGVGKNREKTLGEFVSRIVKHIH 348 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 154 LATVAIDLEDLEDLVGKKNSLEVRTCVAQIGILFA 258 L +AID+ L+ +GKK +L V + +G + + Sbjct: 176 LMAIAIDMNPLKPRMGKKATLCVAASIWIVGTIIS 210 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 628 AYQRVSTTXFRKLLQILDTHLMVR 699 AY++ S F LQIL T +M R Sbjct: 3005 AYEKSSIPGFSVFLQILSTAVMTR 3028 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 299 VLKRSPYEVEEYRNNHEVTVSGVEVHNPIQY 391 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,568 Number of Sequences: 2352 Number of extensions: 15792 Number of successful extensions: 37 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -