BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0866 (345 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 3.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 3.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 3.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 3.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 20 6.2 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 20 8.2 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 187 CTFGCCTLPRSIQVQDKEGALHCPEASTQANLFI 288 C+ GC +L R + DK STQA ++ Sbjct: 226 CSPGCFSLFRGKALMDKSVMKKYTTRSTQAKHYV 259 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 187 CTFGCCTLPRSIQVQDKEGALHCPEASTQANLFI 288 C+ GC +L R + DK STQA ++ Sbjct: 540 CSPGCFSLFRGKALMDKSVMKKYTTRSTQAKHYV 573 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 187 CTFGCCTLPRSIQVQDKEGALHCPEASTQANLFI 288 C+ GC +L R + DK STQA ++ Sbjct: 773 CSPGCFSLFRGKALMDKSVMKKYTTRSTQAKHYV 806 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 187 CTFGCCTLPRSIQVQDKEGALHCPEASTQANLFI 288 C+ GC +L R + DK STQA ++ Sbjct: 773 CSPGCFSLFRGKALMDKSVMKKYTTRSTQAKHYV 806 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.2 bits (40), Expect = 6.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 264 LYTGQFVYCGKKATLEVGNVMPV 332 L+T +F + ATL V N++ V Sbjct: 468 LFTQKFTFVAGLATLSVLNLLSV 490 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 19.8 bits (39), Expect = 8.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 143 IKGVVKDIIHDPGRGAPL 196 + VVKD + DP P+ Sbjct: 451 LASVVKDFVFDPTERTPV 468 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,869 Number of Sequences: 336 Number of extensions: 1539 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6770240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -