BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0866 (345 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 0.77 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 5.4 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 5.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 0.77 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 327 ASHFQLQELLSFHNKQIGLCRGFGTMKSSFLVLNLYGSR 211 AS L+E+ +N L +G T LVLNL G+R Sbjct: 282 ASTRDLREIHLAYNGLRDLPKGIFTRLEQLLVLNLAGNR 320 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 20.6 bits (41), Expect = 5.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 273 LCRGFGTMKSSFLVLNLYGSRKCTTAKGAPLPGSW 169 L G + S + LNL TT+ PL GS+ Sbjct: 226 LTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSY 260 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 20.6 bits (41), Expect = 5.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 273 LCRGFGTMKSSFLVLNLYGSRKCTTAKGAPLPGSW 169 L G + S + LNL TT+ PL GS+ Sbjct: 226 LTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSY 260 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 20.6 bits (41), Expect = 5.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 273 LCRGFGTMKSSFLVLNLYGSRKCTTAKGAPLPGSW 169 L G + S + LNL TT+ PL GS+ Sbjct: 226 LTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSY 260 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 20.6 bits (41), Expect = 5.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 273 LCRGFGTMKSSFLVLNLYGSRKCTTAKGAPLPGSW 169 L G + S + LNL TT+ PL GS+ Sbjct: 294 LTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGSY 328 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,803 Number of Sequences: 438 Number of extensions: 1670 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7812315 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -