BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0865 (559 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.4 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.4 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.4 bits (48), Expect = 1.6 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 280 RCVNFRNIWFSSSTSI-ISKCAILVGNSHSTLECSM 176 RCV + WF+ ST+I I+K L+ L+CS+ Sbjct: 50 RCVFVLDPWFAGSTNIGINKWRFLL-QCLEDLDCSL 84 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 275 TPVLELSPRVLRKRKSL 325 T ++ PR+LRKRK L Sbjct: 401 TAAVDEWPRLLRKRKEL 417 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 275 TPVLELSPRVLRKRKSL 325 T ++ PR+LRKRK L Sbjct: 454 TAAVDEWPRLLRKRKEL 470 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 224 FRYNGSGRAEPDVPKINT 277 FRY GR+ +P +N+ Sbjct: 60 FRYECEGRSAGSIPGVNS 77 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 224 FRYNGSGRAEPDVPKINT 277 FRY GR+ +P +N+ Sbjct: 60 FRYECEGRSAGSIPGVNS 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,029 Number of Sequences: 438 Number of extensions: 2717 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -