BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0863 (493 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 1.5 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 4.6 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.1 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 23.0 bits (47), Expect = 1.5 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 242 ASAHY*NRINRLKIRTSXI--FHISRXHXCXRTELPTLSNTNSMKKYLKQYHYY 87 ASA Y N N + I F + + + P LS TNS Y YY Sbjct: 206 ASATYTNSANSSIWSPASIDSFTLEQHRSWCSSSQPVLSTTNSTTNCYNNYPYY 259 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +3 Query: 243 PRTTHSPRAANPFERLSTINLQNH 314 P T H + P + + I LQ H Sbjct: 9 PPTPHESNTSTPVSKSAFIELQQH 32 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 Query: 152 CXCXGGNEKC 181 C C GN KC Sbjct: 696 CFCENGNNKC 705 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,325 Number of Sequences: 336 Number of extensions: 1543 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -