BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0862 (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 2.9 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 2.9 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 676 GGNSFLHSTHVSSQSRLISYSRWDTTKQSR 587 GGNS +S+ + + L +SRW +R Sbjct: 346 GGNSASNSSGDAQSTSLRPFSRWSLCNSAR 375 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 50 ETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMS 166 +TLG N I EP+ + T K ++ A AP D++ Sbjct: 380 QTLGGSSNEIVEPVPQPVEEVTQKPSSTKAPAPPSRDLT 418 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,153 Number of Sequences: 336 Number of extensions: 4209 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -