BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0861 (634 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|ch... 27 2.3 SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|ch... 26 5.2 SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|c... 25 6.9 SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 25 9.1 >SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 291 HKAIKKTSSSN*NYFFVNTKLNNFITTLRFLTLNLPIVLVYVFL 422 H + ++ SN F + L + LRF LP+ VY FL Sbjct: 234 HLGMDSSTVSNLKRFCFSESLGHIFAPLRFQNQQLPLQHVYAFL 277 >SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 25.8 bits (54), Expect = 5.2 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = +3 Query: 339 VNTKLNNFITTLRFL----TLNLPIVLVYVFLPTAFSNFDPKFIKRSILL--FNK 485 V TK N +TL F TL P+ + + SN DP +KR ILL FNK Sbjct: 8 VFTKPQNHSSTLEFYDFVTTLLEPLSRIGKTRKSKTSNLDPYELKRKILLDYFNK 62 >SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.4 bits (53), Expect = 6.9 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 3/90 (3%) Frame = -1 Query: 481 LNNKIDRFMNFGSKLLNAVGR---NTYTRTIGRFSVKKRKVVIKLFNFVFTKK*F*LDEE 311 L N +D F NF S G + Y S KRK K+ +F+ F + + Sbjct: 199 LENFMDLFDNFYSDKEKTKGAWVVSFYAIMALAVSRSKRKDKEKISKSLFSTSWFLVQKP 258 Query: 310 VFFIALWGDELTAYLVLSGTAAHRHLQRKC 221 FF+ D++ A ++ AH L C Sbjct: 259 GFFLTARLDKIQALTIMIQFCAHLSLYNLC 288 >SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 25.0 bits (52), Expect = 9.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 112 PCLFLPSSSNAFRFEGWGSRCTVKTET*NSCLKVGGSIYVVDVYGLR 252 P F+ + F W S V+ E+ SCL + + V +V G++ Sbjct: 324 PITFVTKNLRKFPIPEWRSSLEVQAESEQSCLPLYPLLPVEEVEGMK 370 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,439,600 Number of Sequences: 5004 Number of extensions: 48245 Number of successful extensions: 121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -