BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0858 (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 1.6 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 5.0 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 8.7 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 613 SNPKYLALASGSSNTHCSRCLTFLVTEWPSICXSFY 506 S PK L + HC R + E P IC FY Sbjct: 94 SRPK---LQEPQPSQHCPRKHGYFAHEEPHICDKFY 126 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 72 FFSLYFILDICGACNFC 22 F+S +FI+++ CN C Sbjct: 274 FWSAFFIVNVLYICNQC 290 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 56 LFWISVVLVTSANVGL 9 L W+ V++ + NVG+ Sbjct: 30 LLWVLFVIIVAGNVGV 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,561 Number of Sequences: 336 Number of extensions: 2715 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -