BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0858 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 1.2 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 25 2.0 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = -3 Query: 428 ESSSELXYLMTPLVANTLRMSSGMEGPMLVDVWIPVFSFSEDFLLLYRSCKCGGRXGP 255 +S E L++ R + G++G V + + ++E+F LY+ C G P Sbjct: 485 DSRVEPQELLSIAAGMVTRKAPGLDGIPNAAVKVAIEEYTEEFCRLYQDCLSRGTFPP 542 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 25.0 bits (52), Expect = 2.0 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 563 FTVFNFFSYRMAFYLXKFLSKARSSRRLWASEYFCSEPTGKGPTQESSS 417 FTV+ F R L K RR + +YF + P G+ SS Sbjct: 228 FTVWRFAGLRRNMTLPKRKPSNLEIRRQLSFQYFSTHPNGRNGILRRSS 276 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,796 Number of Sequences: 2352 Number of extensions: 11199 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -