BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0855 (813 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62990.1 68416.m07076 expressed protein predicted protein, Ar... 29 3.7 At1g68620.1 68414.m07841 expressed protein similar to PrMC3 [Pin... 29 3.7 At5g57130.1 68418.m07135 expressed protein 29 4.9 >At3g62990.1 68416.m07076 expressed protein predicted protein, Arabidopsis thaliana Length = 134 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -3 Query: 676 ATDFDAVFFLIDRVIEEEGLYV**HSLNSGEINNKLQFPKRSEGGSL 536 +TDFD V + D E EG H GE+N+ ++P+R +G +L Sbjct: 63 STDFDTVEEVADVAGENEG-----HVDEDGEVNSYRKWPERRDGENL 104 >At1g68620.1 68414.m07841 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 336 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 22 WEDSARNGNFWVLQRDFGSLY 84 W + ARN N W Q DFG ++ Sbjct: 151 WLNKARNDNLWAKQCDFGRIF 171 >At5g57130.1 68418.m07135 expressed protein Length = 920 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +1 Query: 610 IHINLPLQSLYLLKKKPHQNPLRSYKDLS-IHMGYRDRESDFVLYHGVILK 759 I+ N PL + L + P QNPL S H R RE D L V+++ Sbjct: 132 INPNFPLWQTHFLNQSPDQNPLLLSSSASHHHQQQRLREIDLKLVVDVLMR 182 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,755,188 Number of Sequences: 28952 Number of extensions: 334811 Number of successful extensions: 730 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -