BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0852 (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 3.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 5.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 5.3 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 3.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 358 QQRSYWFXCEVQQGSRHCHSRR 423 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +1 Query: 286 DHACTETNTCRTAHTFQGICCHWRQQRSYWFXCEVQQGSRHCHSRRYY 429 DHA T TC+T + G+ H + F E + H R Y Sbjct: 1805 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLY 1851 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +1 Query: 286 DHACTETNTCRTAHTFQGICCHWRQQRSYWFXCEVQQGSRHCHSRRYY 429 DHA T TC+T + G+ H + F E + H R Y Sbjct: 1806 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLY 1852 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 493,018 Number of Sequences: 2352 Number of extensions: 9548 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -