BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0852 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 3.8 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 6.6 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.7 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 215 KQVNALEFVDFSFANKTAEFGDRNPLFLVF 126 + +++ + V++ T GD P+FL F Sbjct: 355 QDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 Query: 178 KEKSTNSRAFTCFLYQSKNSRSLISSRPV 264 KEK R +C L + +N RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 209 LVFFTNQRIRDH*FLLGPSLNDXVLK 286 L+ T Q+ R+H L+ P+ + VLK Sbjct: 126 LLISTGQKWRNHRKLIAPTFHLNVLK 151 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,426 Number of Sequences: 438 Number of extensions: 2937 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -