BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0848 (817 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39252| Best HMM Match : PEX11 (HMM E-Value=6.4e-35) 38 0.013 SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 >SB_39252| Best HMM Match : PEX11 (HMM E-Value=6.4e-35) Length = 239 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 361 SSRLSNARMMLRLFDDIPMIRHTYNYGLG 447 + RL+ R MLRLFDD+ M H YGLG Sbjct: 52 AGRLAECRTMLRLFDDLSMFFHVKKYGLG 80 Score = 35.1 bits (77), Expect = 0.069 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +2 Query: 257 ELLDSYNGRDKVVRLACYTFKLYGCL 334 ++++SY GRDKV+RL CY+ L G L Sbjct: 9 KIMESYRGRDKVIRLLCYSGMLSGGL 34 >SB_344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = -1 Query: 418 SSGYHQTVVASSWHLRVVSCGLPRLIVGKTSIQLECVTSKTDNLISAIVTVQKLATSSVI 239 SSG+ + + +RV S LIVG + Q+ +S +D LI T Q A SS Sbjct: 203 SSGFDELIGGHDTQVRVCSSSFDELIVGHDT-QVRACSSSSDELIGGHDT-QVGACSSSF 260 Query: 238 DDI 230 D++ Sbjct: 261 DEL 263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,636,224 Number of Sequences: 59808 Number of extensions: 444393 Number of successful extensions: 989 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -