BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0848 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 31 0.017 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 22 7.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.8 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 30.7 bits (66), Expect = 0.017 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 607 VSCLPAGWLWGEKIGSTKVAAIATTSS 687 V C+PAGW+WG++ K+ A+ S Sbjct: 158 VYCVPAGWIWGDQGFLKKLGAVDIAGS 184 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 683 EVVAIAATLVLPIFSP 636 +VV++ T V+P+FSP Sbjct: 150 KVVSVFYTAVIPMFSP 165 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 359 RSAKAYCR*DIHTT*MCNKQDGQPYLCHCNCP 264 RS + CR + H +C+ D C CP Sbjct: 731 RSEQFLCRYEAHCFALCHCCDFDACDCEMTCP 762 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 549 PTSLTGCGSREAVPG 593 PT++T C + E VPG Sbjct: 1201 PTTVTYCQTEEDVPG 1215 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 549 PTSLTGCGSREAVPG 593 PT++T C + E VPG Sbjct: 1197 PTTVTYCQTEEDVPG 1211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,265 Number of Sequences: 438 Number of extensions: 3997 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -