BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0846 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 27 3.3 SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 26 4.3 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 26.6 bits (56), Expect = 3.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 153 CVLAINASANLIVNVLRNLGLCLHIYLSR 239 C LA+NA NL+ + +LG+CL L R Sbjct: 164 CRLAVNAM-NLVTSSFDSLGMCLDTILCR 191 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 26.2 bits (55), Expect = 4.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 126 WDLFSWNYICVLAINASANLIVNVLRNLGLCLHIY 230 W+LF+W ++ VL I L + R GL H Y Sbjct: 472 WELFAWGWLIVLFI-LPERLCCFMSRRTGLTKHPY 505 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,633,412 Number of Sequences: 5004 Number of extensions: 51119 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -