BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0846 (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 29 3.4 SB_41846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 28 7.9 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 420 PYNTXRKIPQHPLITPDSHNTITRFLFXXXXXXNFFC 530 PYN R+ P H TP + + + +F+ F+C Sbjct: 284 PYNESRQQPLHSYTTPSTFDKLKQFIELDRKVLRFYC 320 >SB_41846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +3 Query: 72 DLPVPRVESTSTDVPRKIWDLFSWNYICVLAINASANLIVNVLRNLGLCLHIYL 233 D+P PR+ S D+PR I D SW+ V + L+ V L C Y+ Sbjct: 106 DIPFPRLNRKSKDIPRIIHD--SWS---VRRMKKELALMFTVFVGLIACARTYI 154 >SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2978 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -1 Query: 340 SVIISSSKFKRLVQWVVKQMFYVTSFLIDTNYILRLKYMCRHKPK 206 SVI+ SS +++ W + + S D+NY+L+++Y C H K Sbjct: 2320 SVILKSSDARKIT-WNHQNIH--ASLSNDSNYLLQMRYTCGHHGK 2361 >SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) Length = 871 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/57 (35%), Positives = 27/57 (47%) Frame = +3 Query: 165 INASANLIVNVLRNLGLCLHIYLSRSI*FVSIRNEVT*NICLTTHCTSRLNLLLDII 335 IN L +N+L LC+ I RS F++I + T I T T LLD+I Sbjct: 197 INYKLRLDLNILDLENLCIDINKPRSTPFLTIIHGSTQLIKEATRITENTATLLDVI 253 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,624,141 Number of Sequences: 59808 Number of extensions: 378358 Number of successful extensions: 719 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -