BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0846 (673 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060968-1|AAL28516.1| 57|Drosophila melanogaster GM09783p pro... 29 5.8 AE014296-2034|AAF50006.2| 2523|Drosophila melanogaster CG32092-P... 29 5.8 >AY060968-1|AAL28516.1| 57|Drosophila melanogaster GM09783p protein. Length = 57 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -3 Query: 206 ISQDINNKIRAGIYREHTNIIPAK*IPNLAWNIRRCRLHTRNWQVVLHTVL 54 +S D N+K++ + N IPA WN+ R R+ V +H+ L Sbjct: 6 LSSDANSKLQTANCDDCGNAIPANGFRKFCWNLARDRIEFSAISVWIHSNL 56 >AE014296-2034|AAF50006.2| 2523|Drosophila melanogaster CG32092-PB protein. Length = 2523 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 42 TANLQNCV*NDLPVPRVESTSTDVPRKIWDLFSWNYICVLAINASANLIVN 194 T+NL NC + + VPR S + V ++D F NY V+ + ++ + N Sbjct: 2318 TSNLTNCT-DYIRVPRGYSITLYVMTVLFDSFDNNYFRVIDVQSNKTIFTN 2367 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,511,809 Number of Sequences: 53049 Number of extensions: 523051 Number of successful extensions: 921 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2910007350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -