BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0844 (421 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) 39 0.002 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.17 SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) 31 0.39 SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) 31 0.39 SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) 31 0.39 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) 31 0.51 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.68 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.68 SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) 30 0.68 SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) 30 0.68 SB_19980| Best HMM Match : rve (HMM E-Value=0.91) 30 0.89 SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) 29 1.6 SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_45056| Best HMM Match : rve (HMM E-Value=7.2e-19) 29 2.1 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_51581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_14491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 27 6.3 SB_52158| Best HMM Match : rve (HMM E-Value=5.9e-07) 27 6.3 SB_21867| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) 27 8.3 >SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 51.6 bits (118), Expect = 3e-07 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +3 Query: 255 PLKKL-PKLRXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYA 416 P K+L P + D L++Y G + MAVNG +FDVTRG FYGPGGPY+ Sbjct: 49 PPKRLEPFKKRDFTLDELKEYDGLKSP-YVLMAVNGKVFDVTRGKDFYGPGGPYS 102 >SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 288 MXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 + V L ++ G Q +A+ G ++DV +G RFYGPG Y V Sbjct: 272 LSTVDLVKHDGLQPDANIYIAILGKVYDVEKGRRFYGPGTGYHV 315 >SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) Length = 310 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 L ++ G+Q +A+ G ++DV +G RFYGPG Y V Sbjct: 93 LAKHDGSQPDANIYIAILGKVYDVEKGRRFYGPGTGYHV 131 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 32.3 bits (70), Expect = 0.17 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + A +LC +LP Y + S++ F G + + C Sbjct: 610 SNHAEYVVYRQNVVRARVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 657 >SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 31.9 bits (69), Expect = 0.22 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 345 MAVNGWIFDVTRGNRFYGPGGP 410 +AVNG +FDVT ++GP GP Sbjct: 92 VAVNGKVFDVTSAWNYFGPAGP 113 >SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 337 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 384 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 813 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 860 >SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) Length = 390 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 307 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 354 >SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) Length = 580 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 444 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 491 >SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) Length = 438 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 355 SNHAEYVVYRQNMVRSRVLCAALLPVVYSVSLDSRYNELFTGRSLQSC 402 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 786 SNHAEYVVYRQNVVRSGVLCATLLPVVYSLSLDSRYNELFTGRSLQSC 833 >SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 31.1 bits (67), Expect = 0.39 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 150 SNHAEYVVYRQNVVRSRVLCATLLPVVYSISLDSRYNELFTGRSLQSC 197 >SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2085 Score = 30.7 bits (66), Expect = 0.51 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQCV 234 S+H EY + + LLC +L Y + S++ F G + + CV Sbjct: 2001 SNHAEYVVYRQNVVRSRLLCATLLSVVYSVSLDSRYNELFTGRSLQSCV 2049 >SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) Length = 317 Score = 30.7 bits (66), Expect = 0.51 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 234 SNHAEYLVYRQNVARSRVLCATLLPVVYSVSLVSRYNELFTGRSLQSC 281 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 30.3 bits (65), Expect = 0.68 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 1206 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYYELFTGRSLQSC 1253 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 30.3 bits (65), Expect = 0.68 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + +LC +LP Y + S++ F G + + C Sbjct: 413 SNHAEYVVYRQNVVRPRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 460 >SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) Length = 783 Score = 30.3 bits (65), Expect = 0.68 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + +LC +LP Y + S++ F G + + C Sbjct: 504 SNHAEYVVYRQNVVRTRVLCATLLPVVYSVSLDSRYNELFTGHSLQSC 551 >SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) Length = 511 Score = 30.3 bits (65), Expect = 0.68 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 330 SNHAEYVVHRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 377 >SB_19980| Best HMM Match : rve (HMM E-Value=0.91) Length = 367 Score = 29.9 bits (64), Expect = 0.89 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 284 SNHAEYVVYCQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 331 >SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 ++H EY + +LC +LP Y + S++ F G + + C Sbjct: 159 TNHTEYVVYRQNVVRTRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 206 >SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + +LC +LP Y + S++ F G + + C Sbjct: 911 SNHAEYVVYRQIVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 958 >SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 323 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H E+ + + +LC +LP Y + S++ F G + + C Sbjct: 240 SNHAEHVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 287 >SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H E+ + + +LC +LP Y + S++ F G + + C Sbjct: 462 SNHAEHVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 509 >SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFE 243 S+H EY + + LLC +LP Y + S++ F G + + Sbjct: 140 SNHAEYVVYRQNVVRSRLLCATLLPVVYSVSLDSRYNELFTGRSLQ 185 >SB_45056| Best HMM Match : rve (HMM E-Value=7.2e-19) Length = 479 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S++ G + + C Sbjct: 363 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELITGRSLQSC 410 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +LP Y + S + F G + C Sbjct: 1056 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSCYNELFTGRRLQSC 1103 >SB_51581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -3 Query: 377 SHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 +H EY + + +LC +LP Y S++ F G + + C Sbjct: 49 NHAEYVVYRQNVVRSRVLCAALLPVVYSVSNESRYNELFTGRSLQSC 95 >SB_14491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 27.5 bits (58), Expect = 4.8 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -2 Query: 300 LLRSYLXAI*VVFSRGNL*TMCLILVVKFIQXHKCTHKNKIXKRLTKQCF 151 L R Y + +S NL + L + K + HKC NK+ +TK F Sbjct: 3 LTRMYAEDTTITYSASNLVELELQINSKLSKLHKCLLANKLSLNITKTEF 52 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 27.1 bits (57), Expect = 6.3 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = +2 Query: 209 CINFTTSIRHIVQRLP 256 C+NF T+++H +++LP Sbjct: 508 CLNFPTALQHFIEKLP 523 >SB_52158| Best HMM Match : rve (HMM E-Value=5.9e-07) Length = 367 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +L Y + S++ F G + + C Sbjct: 288 SNHAEYVVYRQNMVRSRVLCATLLLVVYSVSLDSRYNELFTGRSLQSC 335 >SB_21867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 864 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H EY + + +LC +L Y + S++ F G + + C Sbjct: 785 SNHAEYVVYRQNMVRSRVLCATLLLVVYSVSLDSRYNELFTGRSLQSC 832 >SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) Length = 813 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 380 SSHIEYPPIHSHXXSAXLLCPXVLP*XYCXHIXSQFR*FFQGATFEQC 237 S+H +Y + + +LC +LP Y + S+ F G + + C Sbjct: 690 SNHADYVVYRQNVVRSRVLCATLLPVVYSVSLDSRCNELFTGRSLQFC 737 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,513,300 Number of Sequences: 59808 Number of extensions: 212418 Number of successful extensions: 375 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -