BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0844 (421 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ496105-1|ABF47094.1| 223|Homo sapiens progesterone receptor m... 57 2e-08 BC092478-1|AAH92478.1| 223|Homo sapiens progesterone receptor m... 57 2e-08 BC016692-1|AAH16692.1| 223|Homo sapiens progesterone receptor m... 57 2e-08 AJ002030-1|CAA05152.1| 223|Homo sapiens progresterone binding p... 57 2e-08 Y12711-1|CAA73248.1| 195|Homo sapiens putative progesterone bin... 57 3e-08 DQ496104-1|ABF47093.1| 195|Homo sapiens progesterone receptor m... 57 3e-08 CR456993-1|CAG33274.1| 195|Homo sapiens PGRMC1 protein. 57 3e-08 BC034238-1|AAH34238.1| 195|Homo sapiens progesterone receptor m... 57 3e-08 AJ249131-1|CAB65109.1| 109|Homo sapiens progesterone membrane b... 48 1e-05 BC008823-1|AAH08823.1| 172|Homo sapiens neuron derived neurotro... 42 8e-04 AY762102-1|AAX07829.1| 172|Homo sapiens cell growth-inhibiting ... 42 8e-04 AF173937-1|AAD51419.1| 172|Homo sapiens secreted protein of unk... 42 8e-04 AB126219-1|BAD72063.1| 172|Homo sapiens neudesin protein protein. 42 8e-04 AK223135-1|BAD96855.1| 172|Homo sapiens SCIRP10-related protein... 40 0.003 BC051697-1|AAH51697.1| 264|Homo sapiens cytochrome b5 domain co... 29 8.4 BC020263-1|AAH20263.1| 264|Homo sapiens cytochrome b5 domain co... 29 8.4 AK172844-1|BAD18808.1| 264|Homo sapiens protein ( Homo sapiens ... 29 8.4 >DQ496105-1|ABF47094.1| 223|Homo sapiens progesterone receptor membrane component 2 protein. Length = 223 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 255 PLKKLPKLRX-DMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 P LP+++ D LRQY G++ R +AVNG +FDVT+G++FYGP GPY + Sbjct: 91 PATSLPRMKKRDFSLEQLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGI 145 >BC092478-1|AAH92478.1| 223|Homo sapiens progesterone receptor membrane component 2 protein. Length = 223 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 255 PLKKLPKLRX-DMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 P LP+++ D LRQY G++ R +AVNG +FDVT+G++FYGP GPY + Sbjct: 91 PATSLPRMKKRDFSLEQLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGI 145 >BC016692-1|AAH16692.1| 223|Homo sapiens progesterone receptor membrane component 2 protein. Length = 223 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 255 PLKKLPKLRX-DMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 P LP+++ D LRQY G++ R +AVNG +FDVT+G++FYGP GPY + Sbjct: 91 PATSLPRMKKRDFSLEQLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGI 145 >AJ002030-1|CAA05152.1| 223|Homo sapiens progresterone binding protein protein. Length = 223 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 255 PLKKLPKLRX-DMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 P LP+++ D LRQY G++ R +AVNG +FDVT+G++FYGP GPY + Sbjct: 91 PATSLPRMKKRDFSLEQLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGI 145 >Y12711-1|CAA73248.1| 195|Homo sapiens putative progesterone binding protein protein. Length = 195 Score = 56.8 bits (131), Expect = 3e-08 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LPKL-RXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 LP+L R D LR++ G Q+ R MA+NG +FDVT+G +FYGP GPY V Sbjct: 65 LPRLKRRDFTPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGV 115 >DQ496104-1|ABF47093.1| 195|Homo sapiens progesterone receptor membrane component 1 protein. Length = 195 Score = 56.8 bits (131), Expect = 3e-08 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LPKL-RXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 LP+L R D LR++ G Q+ R MA+NG +FDVT+G +FYGP GPY V Sbjct: 65 LPRLKRRDFTPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGV 115 >CR456993-1|CAG33274.1| 195|Homo sapiens PGRMC1 protein. Length = 195 Score = 56.8 bits (131), Expect = 3e-08 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LPKL-RXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 LP+L R D LR++ G Q+ R MA+NG +FDVT+G +FYGP GPY V Sbjct: 65 LPRLKRRDFTPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGV 115 >BC034238-1|AAH34238.1| 195|Homo sapiens progesterone receptor membrane component 1 protein. Length = 195 Score = 56.8 bits (131), Expect = 3e-08 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 267 LPKL-RXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYAV 419 LP+L R D LR++ G Q+ R MA+NG +FDVT+G +FYGP GPY V Sbjct: 65 LPRLKRRDFTPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGV 115 >AJ249131-1|CAB65109.1| 109|Homo sapiens progesterone membrane binding protein protein. Length = 109 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = +3 Query: 267 LPKL-RXDMXAVXLRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGP 401 LP+L R D LR++ G Q+ R MA+NG +FDVT+G +FYGP Sbjct: 65 LPRLKRRDFTPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGP 109 >BC008823-1|AAH08823.1| 172|Homo sapiens neuron derived neurotrophic factor protein. Length = 172 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPY 413 L +Y G +E +AV G +FDVT G FYG G PY Sbjct: 52 LARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPY 88 >AY762102-1|AAX07829.1| 172|Homo sapiens cell growth-inhibiting protein 47 protein. Length = 172 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPY 413 L +Y G +E +AV G +FDVT G FYG G PY Sbjct: 52 LARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPY 88 >AF173937-1|AAD51419.1| 172|Homo sapiens secreted protein of unknown function protein. Length = 172 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPY 413 L +Y G +E +AV G +FDVT G FYG G PY Sbjct: 52 LARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPY 88 >AB126219-1|BAD72063.1| 172|Homo sapiens neudesin protein protein. Length = 172 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPY 413 L +Y G +E +AV G +FDVT G FYG G PY Sbjct: 52 LARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPY 88 >AK223135-1|BAD96855.1| 172|Homo sapiens SCIRP10-related protein variant protein. Length = 172 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPY 413 L +Y G +E +AV G +F+VT G FYG G PY Sbjct: 52 LARYGGEEEDQPIYLAVKGVVFEVTSGKEFYGRGAPY 88 >BC051697-1|AAH51697.1| 264|Homo sapiens cytochrome b5 domain containing 2 protein. Length = 264 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYA 416 L +Y G +A+ G ++DV+ G R Y PG Y+ Sbjct: 43 LSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYS 80 >BC020263-1|AAH20263.1| 264|Homo sapiens cytochrome b5 domain containing 2 protein. Length = 264 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYA 416 L +Y G +A+ G ++DV+ G R Y PG Y+ Sbjct: 43 LSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYS 80 >AK172844-1|BAD18808.1| 264|Homo sapiens protein ( Homo sapiens cDNA FLJ24005 fis, clone KAT01883. ). Length = 264 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 303 LRQYXGTQEGGRXXMAVNGWIFDVTRGNRFYGPGGPYA 416 L +Y G +A+ G ++DV+ G R Y PG Y+ Sbjct: 43 LSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYS 80 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,378,870 Number of Sequences: 237096 Number of extensions: 1057215 Number of successful extensions: 1424 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1424 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3202085264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -