BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0842 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 6e-20 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 1e-19 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 93 3e-19 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 92 4e-19 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 92 4e-19 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 92 4e-19 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 92 4e-19 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 92 4e-19 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 91 8e-19 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 91 8e-19 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 91 8e-19 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 88 5e-18 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 88 7e-18 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 85 4e-17 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 82 4e-16 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 77 1e-14 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 64 1e-10 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 0.001 SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 31 0.66 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 31 1.2 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) 31 1.2 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_18508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_48780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_16123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_15343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_966| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_52036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) 28 8.1 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 95.5 bits (227), Expect = 4e-20 Identities = 48/63 (76%), Positives = 51/63 (80%) Frame = +1 Query: 13 PWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVR 192 P P G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR Sbjct: 20 PSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVR 79 Query: 193 SSD 201 SD Sbjct: 80 PSD 82 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 94.7 bits (225), Expect = 6e-20 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +1 Query: 13 PWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVR 192 P P G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR Sbjct: 21 PRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVR 80 Query: 193 SSD 201 SD Sbjct: 81 PSD 83 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 93.5 bits (222), Expect = 1e-19 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = +1 Query: 19 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 198 P+G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPS 161 Query: 199 D 201 D Sbjct: 162 D 162 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 93.1 bits (221), Expect = 2e-19 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 19 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSS 198 P+G GN +K RAGD LQL +NEEFLVSA+H+LALITSLPFVHTARRYYRLN LVR S Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLPFVHTARRYYRLNGLVRPS 101 Query: 199 D 201 D Sbjct: 102 D 102 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 92.7 bits (220), Expect = 3e-19 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 67 KGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 126 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 92.7 bits (220), Expect = 3e-19 Identities = 47/67 (70%), Positives = 52/67 (77%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 171 ATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 230 Query: 181 DLVRSSD 201 LVR SD Sbjct: 231 GLVRPSD 237 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 92.7 bits (220), Expect = 3e-19 Identities = 47/67 (70%), Positives = 52/67 (77%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 79 ATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Query: 181 DLVRSSD 201 LVR SD Sbjct: 139 GLVRPSD 145 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 91.9 bits (218), Expect = 4e-19 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 80 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 91.9 bits (218), Expect = 4e-19 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 24 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 83 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 91.9 bits (218), Expect = 4e-19 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 24 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 83 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 91.9 bits (218), Expect = 4e-19 Identities = 46/60 (76%), Positives = 50/60 (83%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 80 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 91.9 bits (218), Expect = 4e-19 Identities = 47/67 (70%), Positives = 52/67 (77%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 127 ATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 186 Query: 181 DLVRSSD 201 LVR SD Sbjct: 187 GLVRPSD 193 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 91.9 bits (218), Expect = 4e-19 Identities = 47/67 (70%), Positives = 52/67 (77%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 53 ATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 112 Query: 181 DLVRSSD 201 LVR SD Sbjct: 113 GLVRPSD 119 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 91.9 bits (218), Expect = 4e-19 Identities = 47/67 (70%), Positives = 52/67 (77%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 132 ATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 191 Query: 181 DLVRSSD 201 LVR SD Sbjct: 192 GLVRPSD 198 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 91.1 bits (216), Expect = 8e-19 Identities = 47/67 (70%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 132 ATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLN 191 Query: 181 DLVRSSD 201 LVR SD Sbjct: 192 GLVRPSD 198 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 91.1 bits (216), Expect = 8e-19 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = +1 Query: 22 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 24 KGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 83 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 91.1 bits (216), Expect = 8e-19 Identities = 47/67 (70%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 79 ATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Query: 181 DLVRSSD 201 LVR SD Sbjct: 139 GLVRPSD 145 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 91.1 bits (216), Expect = 8e-19 Identities = 46/63 (73%), Positives = 49/63 (77%) Frame = +1 Query: 13 PWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVR 192 P P G GN +K RAGD +L NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR Sbjct: 17 PSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVR 76 Query: 193 SSD 201 SD Sbjct: 77 PSD 79 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 91.1 bits (216), Expect = 8e-19 Identities = 47/67 (70%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 127 ATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLN 186 Query: 181 DLVRSSD 201 LVR SD Sbjct: 187 GLVRPSD 193 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 91.1 bits (216), Expect = 8e-19 Identities = 47/67 (70%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 79 ATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Query: 181 DLVRSSD 201 LVR SD Sbjct: 139 GLVRPSD 145 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 90.2 bits (214), Expect = 1e-18 Identities = 46/59 (77%), Positives = 48/59 (81%) Frame = +1 Query: 25 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 80 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 89.0 bits (211), Expect = 3e-18 Identities = 46/67 (68%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR YYRLN Sbjct: 79 ATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARGYYRLN 138 Query: 181 DLVRSSD 201 LVR SD Sbjct: 139 GLVRPSD 145 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 88.6 bits (210), Expect = 4e-18 Identities = 45/57 (78%), Positives = 47/57 (82%) Frame = +1 Query: 31 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 59 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 88.6 bits (210), Expect = 4e-18 Identities = 46/67 (68%), Positives = 51/67 (76%) Frame = +1 Query: 1 SACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLN 180 + C+ G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 79 ATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Query: 181 DLVRSSD 201 LVR SD Sbjct: 139 GLVRPSD 145 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 88.6 bits (210), Expect = 4e-18 Identities = 45/57 (78%), Positives = 47/57 (82%) Frame = +1 Query: 31 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 59 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 88.2 bits (209), Expect = 5e-18 Identities = 44/57 (77%), Positives = 48/57 (84%) Frame = +1 Query: 31 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN L+R SD Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLLRPSD 59 Score = 35.9 bits (79), Expect = 0.031 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +2 Query: 233 CWEVDQTYHLEEVKVVTRFP 292 C +V QT HLEEVKVVTRFP Sbjct: 71 CRKVGQTDHLEEVKVVTRFP 90 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 87.8 bits (208), Expect = 7e-18 Identities = 45/59 (76%), Positives = 48/59 (81%) Frame = +1 Query: 25 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 196 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 87.0 bits (206), Expect = 1e-17 Identities = 44/57 (77%), Positives = 47/57 (82%) Frame = +1 Query: 31 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LV SD Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVTPSD 59 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 86.6 bits (205), Expect = 2e-17 Identities = 44/59 (74%), Positives = 47/59 (79%) Frame = +1 Query: 25 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 G GN +K RAGD +L NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 24 GVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 82 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 85.4 bits (202), Expect = 4e-17 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 52 RAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 134 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 82.2 bits (194), Expect = 4e-16 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 31 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDL 186 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTARRYYRLN L Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGL 54 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 77.4 bits (182), Expect = 1e-14 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = +1 Query: 70 LQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 73 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 77.4 bits (182), Expect = 1e-14 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = +1 Query: 70 LQLSPINEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 LQL NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 73 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.9 bits (176), Expect = 5e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 85 INEEFLVSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 +NEEFLVSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 7 LNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRPSD 45 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 40 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 72 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 15 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 47 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSSD 201 VSASH+LALITSLPFVHTARRYYRLN LVR SD Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLNGLVRPSD 46 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 61.3 bits (142), Expect = 7e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 103 VSASHKLALITSLPFVHTARRYYRLNDLVRSS 198 VSASH+LALITSLPFVHTARRYYRLN LVR S Sbjct: 92 VSASHQLALITSLPFVHTARRYYRLNGLVRPS 123 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -2 Query: 199 PKTSLNHSIGSSDGRCVQRAGT*STRAYDSRLLGIPR 89 P S +HSIGSSDGRCVQRAGT S D RLLGIPR Sbjct: 31 PLNSPSHSIGSSDGRCVQRAGTQSMHIDDMRLLGIPR 67 >SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -2 Query: 295 LRKPCYDFYFL*MISLVNFPTTP-TAVKPPRVGPKTSLNHSIGSSDG 158 LRKPCYDFYFL MI P + K SLNHSIGSSDG Sbjct: 3 LRKPCYDFYFLYMIKFDQLFDNPWLRCRGRGANQKASLNHSIGSSDG 49 >SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 310 PSXGS-LRKPCYDFYFL*MISLVNFPTTPTAVKPPR-VGPKTSLNHSIGSSDG 158 PS GS PCYDFYFL MI P R K SLNHSIGSSDG Sbjct: 3 PSAGSPYENPCYDFYFLKMIKFDQLFDNPRLRCRGRGANQKASLNHSIGSSDG 55 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCVQRAG 137 K SLNHSIGSSDGRCVQRAG Sbjct: 23 KASLNHSIGSSDGRCVQRAG 42 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = -2 Query: 121 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 2 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 >SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 31.5 bits (68), Expect = 0.66 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K SLNHSIGSSDGR + Sbjct: 23 KASLNHSIGSSDGRSI 38 >SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) Length = 108 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDGR 155 K SLNHSIGSSDGR Sbjct: 23 KASLNHSIGSSDGR 36 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 196 KTSLNHSIGSSDGRCV 149 K S+NHSIGSSDGR + Sbjct: 91 KASVNHSIGSSDGRSI 106 >SB_18508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = +1 Query: 97 FLVSASHKLALITSLPFVHTARRYYRLNDLVRSSDRHAVASRPSALLGS*PNLSF-RGSK 273 FL + LA+I+ L HT RR+YR + D H V ++ P + F GSK Sbjct: 180 FLTWPALLLAVISYLKCCHTLRRFYRQQE---KQDDHEVRNKGCVPGRITPLIRFISGSK 236 Query: 274 SR--NKVSVGN 300 S N +++GN Sbjct: 237 SNPSNHIALGN 247 >SB_48780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -2 Query: 151 VQRAGT*STRAYDSRLLGIPRLW---GIIANPNPQHEGVS 41 VQ G TR+Y S L +W G+ NP+PQ +G S Sbjct: 535 VQTVGKAPTRSYHSCTLYRGEMWVIGGVYPNPDPQPDGCS 574 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 325 LYCVXYVNI-LFIYLYIYTHAYIRSFLIFIVYPISH 429 +Y Y+ I ++IY+YIYT+ Y ++ Y ++ Sbjct: 11 IYIYIYIYIYIYIYIYIYTYTYTYTYTYTYTYTYTY 46 >SB_16123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_15343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_52036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 196 KTSLNHSIGSSDG 158 K SLNHSIGSSDG Sbjct: 23 KASLNHSIGSSDG 35 >SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) Length = 807 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 337 THNTTHVNDPSXGSLRKPCYDFYFL*MISLVNFPTTPTAVKPPRVGPKT 191 TH +P S +P + Y L +S VN+PT+ ++ PR P+T Sbjct: 709 THTPEPQQEPEVQSHMEPDHVRYMLERMS-VNYPTSRSSFVDPRTYPRT 756 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,254,983 Number of Sequences: 59808 Number of extensions: 362410 Number of successful extensions: 1231 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1198 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -