BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0841 (444 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 39 0.002 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 39 0.002 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 39 0.002 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 39 0.002 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 38 0.004 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.005 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.005 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.005 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 38 0.005 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.005 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.005 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 38 0.005 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 38 0.005 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 38 0.005 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 38 0.005 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 38 0.005 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 38 0.005 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 38 0.005 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 38 0.005 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 38 0.005 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.005 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 38 0.005 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.005 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 38 0.005 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 38 0.005 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 38 0.005 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 38 0.005 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 38 0.005 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 38 0.005 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.005 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 38 0.005 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 38 0.005 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 38 0.005 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 38 0.005 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 38 0.005 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 38 0.005 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 38 0.005 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 38 0.005 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 38 0.005 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 38 0.005 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 38 0.005 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 38 0.005 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 38 0.005 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 38 0.005 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 38 0.005 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 38 0.005 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 38 0.005 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 38 0.005 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 38 0.005 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 38 0.005 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 38 0.005 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 38 0.005 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 38 0.005 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 38 0.005 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 38 0.005 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 38 0.005 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 38 0.005 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 38 0.005 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.005 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 38 0.005 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 38 0.005 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 38 0.005 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 38 0.005 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 38 0.005 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33093| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 38 0.005 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 42.7 bits (96), Expect = 1e-04 Identities = 22/38 (57%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDVPT-ACVAVAETEPSNP 113 T AAALELVDPPGCRNS D P A +T+P P Sbjct: 27 TAVAAALELVDPPGCRNSMPDRPRHAARPTHDTQPDRP 64 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 40.3 bits (90), Expect = 7e-04 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -1 Query: 147 HAAIQQ*LVSKVGXXXXXXXXXXXXXXXXVPNSCSPGDPLVLERPHP 7 H A+ Q LV V NSCSPGDPLVLERP P Sbjct: 42 HCALHQDLVESVPHSLQMLAFSCVSCVVQKSNSCSPGDPLVLERPPP 88 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/38 (55%), Positives = 22/38 (57%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDVPTACVAVAETEPSNPP 116 T AAALELVDPPGCRNS + A V E S P Sbjct: 7 TAVAAALELVDPPGCRNSIEVIRDAAGNVVELRCSYDP 44 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 70 GTSRAEFLQPGGSTSSRAAAPXV 2 G SR EFLQPGGSTSSRAAA V Sbjct: 7 GESRIEFLQPGGSTSSRAAATAV 29 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +3 Query: 12 AAALELVDPPGCRNSARDVPTACV 83 AAALELVDPPGCRNS R T + Sbjct: 10 AAALELVDPPGCRNSIRSTTTITI 33 >SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/46 (45%), Positives = 25/46 (54%) Frame = -3 Query: 139 DPAMTGKQGGFDGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 D ++ GG S +G + EFLQPGGSTSSRAAA V Sbjct: 6 DTLISANIGGARNSPPPPPPPPLGRQKIEFLQPGGSTSSRAAATAV 51 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 70 GTSRAEFLQPGGSTSSRAAAPXV 2 G SR EFLQPGGSTSSRAAA V Sbjct: 47 GFSRIEFLQPGGSTSSRAAATAV 69 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 106 DGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 D +SA Q T EFLQPGGSTSSRAAA V Sbjct: 6 DTLISANIRQRKHTLSIEFLQPGGSTSSRAAATAV 40 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDV 68 T AAALELVDPPGCRNS R V Sbjct: 7 TAVAAALELVDPPGCRNSIRTV 28 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARD 65 T AAALELVDPPGCRNS +D Sbjct: 7 TAVAAALELVDPPGCRNSIKD 27 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDV 68 T AAALELVDPPGCRNS D+ Sbjct: 7 TAVAAALELVDPPGCRNSMDDI 28 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 38.7 bits (86), Expect = 0.002 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARD--VPTAC-VAVAETEPSNPPCLPVI 131 T AAALELVDPPGCRNS D VP V A + +P++ Sbjct: 7 TAVAAALELVDPPGCRNSIEDFNVPAVLQVTFAAGDTKKDIVIPIV 52 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/45 (46%), Positives = 24/45 (53%) Frame = -3 Query: 136 PAMTGKQGGFDGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 P G + + S +T R EFLQPGGSTSSRAAA V Sbjct: 39 PTDPGTRNDTEESPKSTPRNCGNGQRIEFLQPGGSTSSRAAATAV 83 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = -3 Query: 130 MTGKQGGFDGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 ++ G F V T V EFLQPGGSTSSRAAA V Sbjct: 28 LSNNYGNFSKDVKLTQ-HTVSEKEIEFLQPGGSTSSRAAATAV 69 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 70 GTSRAEFLQPGGSTSSRAAAPXV 2 G S+ EFLQPGGSTSSRAAA V Sbjct: 18 GRSKIEFLQPGGSTSSRAAATAV 40 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 73 VGTSRAEFLQPGGSTSSRAAAPXV 2 +G S EFLQPGGSTSSRAAA V Sbjct: 31 LGLSNIEFLQPGGSTSSRAAATAV 54 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDVPTA 77 T AAALELVDPPGCRNS + T+ Sbjct: 7 TAVAAALELVDPPGCRNSMENARTS 31 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARD 65 T AAALELVDPPGCRNS D Sbjct: 24 TAVAAALELVDPPGCRNSIMD 44 >SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 73 VGTSRAEFLQPGGSTSSRAAAPXV 2 +G S EFLQPGGSTSSRAAA V Sbjct: 21 LGVSMIEFLQPGGSTSSRAAATAV 44 >SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -3 Query: 88 TATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 T Q+ G EFLQPGGSTSSRAAA V Sbjct: 8 TKDQSGGNKDIEFLQPGGSTSSRAAATAV 36 >SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.004 Identities = 20/37 (54%), Positives = 22/37 (59%) Frame = -3 Query: 112 GFDGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 G G +S T + EFLQPGGSTSSRAAA V Sbjct: 4 GNTGKLSQGNTGKLSQGNIEFLQPGGSTSSRAAATAV 40 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 11 NSCSPGDPLVLERPPP 26 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 28 NSCSPGDPLVLERPPP 43 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 185 NSCSPGDPLVLERPPP 200 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 80 NSCSPGDPLVLERPPP 95 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 350 NSCSPGDPLVLERPPP 365 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 28 NSCSPGDPLVLERPPP 43 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 103 NSCSPGDPLVLERPPP 118 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 32 NSCSPGDPLVLERPPP 47 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 83 NSCSPGDPLVLERPPP 98 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 517 NSCSPGDPLVLERPPP 532 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 383 NSCSPGDPLVLERPPP 398 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 32 NSCSPGDPLVLERPPP 47 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 9 NSCSPGDPLVLERPPP 24 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 55 NSCSPGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 263 NSCSPGDPLVLERPPP 278 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 26 NSCSPGDPLVLERPPP 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 164 NSCSPGDPLVLERPPP 179 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 22 NSCSPGDPLVLERPPP 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 65 NSCSPGDPLVLERPPP 80 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 49 NSCSPGDPLVLERPPP 64 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 114 NSCSPGDPLVLERPPP 129 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 894 NSCSPGDPLVLERPPP 909 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 26 NSCSPGDPLVLERPPP 41 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 44 NSCSPGDPLVLERPPP 59 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 95 NSCSPGDPLVLERPPP 110 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 66 NSCSPGDPLVLERPPP 81 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 877 NSCSPGDPLVLERPPP 892 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 64 NSCSPGDPLVLERPPP 79 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNSARDVPTACVAVAETEPS 107 T AAALELVDPPGCRNS A + + E S Sbjct: 7 TAVAAALELVDPPGCRNSIHKALDAAIDKIQFEGS 41 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 65 NSCSPGDPLVLERPPP 80 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 44 NSCSPGDPLVLERPPP 59 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 40 NSCSPGDPLVLERPPP 55 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 22 NSCSPGDPLVLERPPP 37 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -3 Query: 103 GSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 G +S A++A T EFLQPGGSTSSRAAA V Sbjct: 8 GILSRRASKAASTV-IEFLQPGGSTSSRAAATAV 40 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 42 NSCSPGDPLVLERPPP 57 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 41 NSCSPGDPLVLERPPP 56 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 26 NSCSPGDPLVLERPPP 41 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 143 NSCSPGDPLVLERPPP 158 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 484 NSCSPGDPLVLERPPP 499 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 82 NSCSPGDPLVLERPPP 97 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 37 NSCSPGDPLVLERPPP 52 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 62 NSCSPGDPLVLERPPP 77 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.005 Identities = 22/39 (56%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +3 Query: 3 TXGAAALELVDPPGCRNS----ARDVPTACVAVAETEPS 107 T AAALELVDPPGCRNS A+ A A+T PS Sbjct: 7 TAVAAALELVDPPGCRNSMKPAAKKPKAAKKPAAKTTPS 45 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 55 NSCSPGDPLVLERPPP 70 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 24 NSCSPGDPLVLERPPP 39 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 35 NSCSPGDPLVLERPPP 50 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 205 NSCSPGDPLVLERPPP 220 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 48 NSCSPGDPLVLERPPP 63 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 1023 NSCSPGDPLVLERPPP 1038 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 122 NSCSPGDPLVLERPPP 137 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 24 NSCSPGDPLVLERPPP 39 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 9 NSCSPGDPLVLERPPP 24 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 64 NSCSPGDPLVLERPPP 79 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 24 NSCSPGDPLVLERPPP 39 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 193 NSCSPGDPLVLERPPP 208 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 44 NSCSPGDPLVLERPPP 59 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 31 NSCSPGDPLVLERPPP 46 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 40 NSCSPGDPLVLERPPP 55 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 40 NSCSPGDPLVLERPPP 55 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 61 NSCSPGDPLVLERPPP 76 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 85 NSCSPGDPLVLERPPP 100 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 11 NSCSPGDPLVLERPPP 26 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 52 NSCSPGDPLVLERPPP 67 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 37.5 bits (83), Expect = 0.005 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = -3 Query: 142 RDPAMTGKQGGF----DGSVSATATQAVGTSRAEFLQPGGSTSSRAAAPXV 2 R P GK G +G + AV ++ EFLQPGGSTSSRAAA V Sbjct: 14 RRPFSLGKTYGVYMSDNGRSQRSKQAAVRRAQIEFLQPGGSTSSRAAATAV 64 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 42 NSCSPGDPLVLERPPP 57 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 119 NSCSPGDPLVLERPPP 134 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 68 NSCSPGDPLVLERPPP 83 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 243 NSCSPGDPLVLERPPP 258 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 186 NSCSPGDPLVLERPPP 201 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 9 NSCSPGDPLVLERPPP 24 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) Length = 608 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 24 NSCSPGDPLVLERPPP 39 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 65 NSCSPGDPLVLERPPP 80 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 58 NSCSPGDPLVLERPPP 73 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 58 NSCSPGDPLVLERPPP 73 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 1068 NSCSPGDPLVLERPPP 1083 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 136 NSCSPGDPLVLERPPP 151 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 79 NSCSPGDPLVLERPPP 94 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 92 NSCSPGDPLVLERPPP 107 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 64 SRAEFLQPGGSTSSRAAAPXV 2 SR EFLQPGGSTSSRAAA V Sbjct: 15 SRIEFLQPGGSTSSRAAATAV 35 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 158 NSCSPGDPLVLERPPP 173 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 170 NSCSPGDPLVLERPPP 185 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 22 NSCSPGDPLVLERPPP 37 >SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 35 NSCSPGDPLVLERPPP 50 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 54 NSCSPGDPLVLERPPP 69 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 53 NSCSPGDPLVLERPPP 68 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 31 NSCSPGDPLVLERPPP 46 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 138 NSCSPGDPLVLERPPP 153 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 81 NSCSPGDPLVLERPPP 96 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 104 NSCSPGDPLVLERPPP 119 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 72 NSCSPGDPLVLERPPP 87 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 71 NSCSPGDPLVLERPPP 86 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 68 NSCSPGDPLVLERPPP 83 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 34 NSCSPGDPLVLERPPP 49 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 216 NSCSPGDPLVLERPPP 231 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 560 NSCSPGDPLVLERPPP 575 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 9 NSCSPGDPLVLERPPP 24 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 82 NSCSPGDPLVLERPPP 97 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 37 NSCSPGDPLVLERPPP 52 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 80 NSCSPGDPLVLERPPP 95 >SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 34 NSCSPGDPLVLERPPP 49 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 10 NSCSPGDPLVLERPPP 25 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 162 NSCSPGDPLVLERPPP 177 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 481 NSCSPGDPLVLERPPP 496 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 54 NSCSPGDPLVLERPHP 7 NSCSPGDPLVLERP P Sbjct: 16 NSCSPGDPLVLERPPP 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,218,045 Number of Sequences: 59808 Number of extensions: 232540 Number of successful extensions: 2849 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2849 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -