BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0841 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 0.86 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 3.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 3.5 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.8 bits (49), Expect = 0.86 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 64 SRAEFLQPGGSTSSRAA 14 ++ EFL PGGS R A Sbjct: 66 AKCEFLNPGGSVKDRIA 82 Score = 22.6 bits (46), Expect = 2.0 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 34 IPRAAGIRHEMYQQPVSQSPKPNHQTHLAYQSLLD 138 IP++ GI+ E+Y + +P + + +AY+ + D Sbjct: 54 IPKSYGIKCEIYAKCEFLNPGGSVKDRIAYRMIQD 88 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/40 (22%), Positives = 17/40 (42%) Frame = -3 Query: 193 LLRPNRCRRYPLR*HSRRDPAMTGKQGGFDGSVSATATQA 74 LL P+RC + + + + GG+D + + A Sbjct: 15 LLHPSRCTQGKVNYREKEKEVLDNILGGYDARIRPSGENA 54 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/40 (22%), Positives = 17/40 (42%) Frame = -3 Query: 193 LLRPNRCRRYPLR*HSRRDPAMTGKQGGFDGSVSATATQA 74 LL P+RC + + + + GG+D + + A Sbjct: 15 LLHPSRCTQGKVNYREKEKEVLDNILGGYDARIRPSGENA 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,229 Number of Sequences: 438 Number of extensions: 1888 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -