BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0840 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 34 0.11 SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) 32 0.57 SB_8542| Best HMM Match : PT (HMM E-Value=4) 31 0.76 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.00 SB_30534| Best HMM Match : EGF (HMM E-Value=0.12) 31 1.3 SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14) 30 1.7 SB_39471| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 3.0 SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 3.0 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_39727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 29 5.3 SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) 29 5.3 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 29 5.3 SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) 28 7.0 SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 34.3 bits (75), Expect = 0.11 Identities = 38/135 (28%), Positives = 49/135 (36%), Gaps = 1/135 (0%) Frame = +3 Query: 225 IGHSAAARSRRSDDNLEFKRDPDKEGKMYGPYGAPNYGG-QPKLSFLMELRSKMPDQPQA 401 IG + R S D+ DPD K P G N G + L EL +K P Q + Sbjct: 45 IGKNQTERQSWSSDST--LSDPDTP-KGPSPDGKVNEPGLRQHTKGLRELPTK-PSQSTS 100 Query: 402 GSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTRNPR*YRATTRVRRIYPESS 581 S+ T F + P P + P P V+ TR P + P SS Sbjct: 101 QSSGTPEFSRIGRSPIVSPVSREFSPKPTRTVFEFQPQITRQPSFEERKPLHSPVSPTSS 160 Query: 582 TSRHYPNYTTNQSPK 626 S PN +PK Sbjct: 161 FSEASPNTPPKTAPK 175 >SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) Length = 784 Score = 31.9 bits (69), Expect = 0.57 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +3 Query: 405 STPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATT--RNPR*YRATTRVRRIYPES 578 STP T +I PYY P PVYS+P TT ++P Y T R I P Sbjct: 104 STPVHT----TDIQHPGPYYRYTAPRSILPVYSTPVHTTSIQHPGPYYQYTAPRSILPVY 159 Query: 579 STSRH 593 +T H Sbjct: 160 NTPVH 164 >SB_8542| Best HMM Match : PT (HMM E-Value=4) Length = 650 Score = 31.5 bits (68), Expect = 0.76 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 10/118 (8%) Frame = +3 Query: 309 YGPYG--APNY--GGQPKLSFLM----ELRSKMPDQPQAGSTPTTTFGQRNNIPDH-QPY 461 Y PYG P Y G P+ + + + R PQ P+ R +P + QP Sbjct: 346 YYPYGNPQPKYYPSGNPQSRYYLYGNPQSRYYPSGNPQPRYYPSGNPQPRYYLPGNPQPR 405 Query: 462 YEDNLP-SPQPPVYSSPTATTRNPR*YRATTRVRRIYPESSTSRHYPNYTTNQSPKRY 632 Y LP +PQP Y S +T + +++T +V ++ ++ R+YP + N P+ Y Sbjct: 406 YY--LPGNPQPRYYRSWKSTVQVLPLWKSTAQVLPLWKSTAQPRYYP--SGNPQPRYY 459 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 1.00 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = +3 Query: 420 TFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTRNPR*YRATTRVRRIYPESSTSRHYP 599 T Q N+P +QPY + N P+ QP + PT N + T + P + + Sbjct: 197 TLHQPTNLPPNQPYKQTNQPTNQPT--NQPTNQPTNQPTNQPTNQPTN-QPTNQPTNQPT 253 Query: 600 NYTTNQS 620 N TNQ+ Sbjct: 254 NQPTNQT 260 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 396 QAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTRNP 530 Q + PT + N P +QP NLP+ QP + TT P Sbjct: 247 QPTNQPTNQPTNQTNQPTNQPNQPTNLPTDQPTNQPANLQTTHAP 291 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 31.1 bits (67), Expect = 1.00 Identities = 27/128 (21%), Positives = 58/128 (45%) Frame = +3 Query: 246 RSRRSDDNLEFKRDPDKEGKMYGPYGAPNYGGQPKLSFLMELRSKMPDQPQAGSTPTTTF 425 + R+ N + K+ ++GK GP + G + S +S+ ++ + STP+ + Sbjct: 85 KPRKDSSNSDTKKKHKRKGKSSGP----DDGNRTTGSLSPVSKSRWKERTPSDSTPSKSR 140 Query: 426 GQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTRNPR*YRATTRVRRIYPESSTSRHYPNY 605 ++P P E+ + P P Y + + +P Y+ +++ P+ + S + P Sbjct: 141 DSFRHVPIVSPPLEEPVSPPLPWAYRKHSPSV-SPPIYKGREQLKSKSPKRTWS-NSPFR 198 Query: 606 TTNQSPKR 629 ++SP R Sbjct: 199 HKSRSPFR 206 >SB_30534| Best HMM Match : EGF (HMM E-Value=0.12) Length = 521 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/60 (33%), Positives = 23/60 (38%) Frame = +3 Query: 453 QPYYEDNLPSPQPPVYSSPTATTRNPR*YRATTRVRRIYPESSTSRHYPNYTTNQSPKRY 632 +P E P QPP P TR P + R PE+ T R P T PK Y Sbjct: 265 KPRTEKPRPITQPPTTQRPRPKTRRPEPRTELPQPRTYRPETRTYRPDPR-TYRPDPKTY 323 >SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14) Length = 1085 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +3 Query: 393 PQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTAT--TRNPR*YRATTRVRRI 566 P G+T TTT NN ++P + L P P ++ T N YR + + + Sbjct: 512 PPPGTTTTTTAPWNNNNNHYRPLEQQQLLLPSPGTTTTTTTVPWNNNNNYYRPLEQQQLL 571 Query: 567 YPESSTSRHYPNYTTNQSPKRYWKRI 644 P +T+ N + Y++R+ Sbjct: 572 LPPGTTTTTTTTACCNNN-NYYYRRL 596 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +3 Query: 393 PQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATT-RNPR*YRATTRVRRIY 569 P G+T TTT NN ++P + L P P ++ T N YR + +++ Sbjct: 753 PSPGTTTTTTAPWNNNNNYYRPLEQQQLLLPSPGTTTTTTTVPWNNNNYYRPLEQQQQLL 812 Query: 570 PESSTS 587 P T+ Sbjct: 813 PSPGTT 818 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = +3 Query: 369 LRSKMPDQPQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTAT-TRNPR*YRA 545 L K P G+T TTT NN ++P + P P ++ TA N YR Sbjct: 715 LEQKQQLLPSPGTTTTTTTVPWNNYYYYRPLEQQQQLLPSPGTTTTTTAPWNNNNNYYRP 774 Query: 546 TTRVRRIYPESSTS 587 + + + P T+ Sbjct: 775 LEQQQLLLPSPGTT 788 >SB_39471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +3 Query: 378 KMPDQPQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATT 521 + P+QP G PT GQ+ N P Q + P P PT TT Sbjct: 67 QQPNQP-TGQQPTDPTGQQPNDPTGQQPTDPTGQQPNQPTGQQPTDTT 113 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +3 Query: 378 KMPDQPQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATT 521 + P+ P G PT GQ+ N P Q + P P PT TT Sbjct: 83 QQPNDP-TGQQPTDPTGQQPNQPTGQQPTDTTDQQPNQPTGQQPTDTT 129 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +3 Query: 474 LPSPQPPVYSSPTAT---TRNPR*YRATTRVRRIYPESSTSRHYPNYTTNQSPKR 629 +P PP +SP + +R+PR +R+T+R R S S Y + ++SP+R Sbjct: 486 VPPSTPPKKTSPDQSRSRSRSPRSHRSTSRSPRRRHSPSVSPPYRRRSRSRSPQR 540 >SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = +2 Query: 512 SDNTQSEMIPSYDSSPQDLSREFDESPLPELHHKSKSEALLETNFDFDDDTSPLPISEAV 691 SD T S D +P SR D +P+P + L D D +P P S+ Sbjct: 92 SDRTPVPPSRSSDLTPVPPSRRSDLAPVPPSRRSDLTPVPLSRRSDLRSDWTPAPPSKIC 151 Query: 692 ART 700 RT Sbjct: 152 GRT 154 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/88 (27%), Positives = 32/88 (36%), Gaps = 7/88 (7%) Frame = +3 Query: 288 PDKEGKMYGPYGAPNYGGQPKLSFLMELRSKMPDQPQA-------GSTPTTTFGQRNNIP 446 P K G P P G P SF + P + QA +TP R+ +P Sbjct: 272 PPKRGSSNPP--PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Query: 447 DHQPYYEDNLPSPQPPVYSSPTATTRNP 530 P + P PP+ PT+T P Sbjct: 330 LPPPPLRGQIAPPPPPISKPPTSTRSAP 357 >SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/69 (24%), Positives = 33/69 (47%) Frame = +2 Query: 515 DNTQSEMIPSYDSSPQDLSREFDESPLPELHHKSKSEALLETNFDFDDDTSPLPISEAVA 694 + TQS+ P +S D +R +D+ P P + K++ + + ++ TSP P + Sbjct: 964 ETTQSKDRPPAES---DRNRSWDKQPSPRIGRKNQQQLTIPSDSSSSPSTSPQPARRNIP 1020 Query: 695 RTVNFRNGN 721 V +G+ Sbjct: 1021 IIVRPSDGD 1029 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/88 (27%), Positives = 32/88 (36%), Gaps = 7/88 (7%) Frame = +3 Query: 288 PDKEGKMYGPYGAPNYGGQPKLSFLMELRSKMPDQPQA-------GSTPTTTFGQRNNIP 446 P K G P P G P SF + P + QA +TP R+ +P Sbjct: 184 PPKRGSSNPP--PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Query: 447 DHQPYYEDNLPSPQPPVYSSPTATTRNP 530 P + P PP+ PT+T P Sbjct: 242 LPPPPLRGQIAPPPPPISKPPTSTRSAP 269 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = +3 Query: 345 PKLSFLMELRSKMPDQPQAGSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTR 524 PK S L + ++ P P S+P T G + + +P + P P + TT+ Sbjct: 401 PKSSALTGVTARKPSMPGPTSSPGATQGSTDGVVSAKPPTKKTTPQSVIPPGKTTAPTTK 460 Query: 525 NP 530 P Sbjct: 461 PP 462 >SB_39727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 29.1 bits (62), Expect = 4.0 Identities = 26/88 (29%), Positives = 32/88 (36%), Gaps = 1/88 (1%) Frame = +3 Query: 291 DKEGKMYGPYGAPNYGGQPKLSFLMELRSKMPDQPQAGSTPTTTFGQRNNIPDHQPYYED 470 D G+ Y G G LS E +P TP TT Q NN P + Sbjct: 160 DFGGRHYLVVGDRLSGWVEVLSSTAECNQTVPPAEPVAETPPTT--QANNDPVSSCMPDA 217 Query: 471 NLPSPQP-PVYSSPTATTRNPR*YRATT 551 + +PQP P PT P+ Y T Sbjct: 218 SSQAPQPLPEPRRPTRARTRPKRYEPET 245 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Frame = +3 Query: 354 SFLMELRSKMPDQPQAGSTPTTTFGQRNNIPDHQ-----PYYEDNL-PSPQPPVYSSPTA 515 + L E++S+ A +PT+T N P HQ P + ++ SPQP YSSP A Sbjct: 97 AMLKEIQSQQSATVVAVYSPTSTAPSSPNTPRHQTDSRLPIAKTSIEASPQPISYSSPFA 156 >SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) Length = 1828 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 554 SPQDLSREFDESPLPELHHKSKSEALLETNFDFDDD 661 S DL D P+L +K S++ L T+ D DDD Sbjct: 1362 SATDLKEAHDNEWDPQLEYKIPSKSSLRTSADLDDD 1397 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 28.7 bits (61), Expect = 5.3 Identities = 28/135 (20%), Positives = 54/135 (40%) Frame = +3 Query: 222 RIGHSAAARSRRSDDNLEFKRDPDKEGKMYGPYGAPNYGGQPKLSFLMELRSKMPDQPQA 401 + G + S S N + ++ + GKM G G+ + GG+PK + + D+ Q Sbjct: 716 KFGTGTPSNSEASQGNPDANQE-NITGKMTGKNGSESPGGEPKKEKNVSQAASNVDKEQK 774 Query: 402 GSTPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATTRNPR*YRATTRVRRIYPESS 581 S T+ N+ ++ + +P+ + S T + P R E+ Sbjct: 775 SSGSTSDSKNTNSSNGNKEKLLSQISTPKETLSDS---TDKRPVLELPRPVDNRKPAETQ 831 Query: 582 TSRHYPNYTTNQSPK 626 + PN + ++ PK Sbjct: 832 DNSEVPNKSVSRLPK 846 >SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) Length = 809 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 506 SYSDNTQSEMIPSYDSSPQDLSREFDESPLPELHHKSKSE 625 +YS N ++ P +S PQ + + DES P H K + + Sbjct: 562 NYSGNGKAVEKPREESIPQQTTSKRDESKTPSQHRKQQEK 601 >SB_54819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +3 Query: 576 SSTSRHYPNYTTNQSPKRYWKRISILTTTPALCRFRKLSLAQS 704 S +S H+P T +SP Y R + +P++ R +++ +S Sbjct: 43 SPSSSHHPQITIVRSPSSYHHRHITIVISPSIYHHRHITILRS 85 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.3 bits (60), Expect = 7.0 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = +3 Query: 309 YGPYGAPNYGGQPKLSFLMELRS-KMPDQPQAG-STPTTTFGQRNNIPDHQPYYEDNLPS 482 + P+G P G P+ R +P QPQ +T GQ P H ++ P Sbjct: 379 FRPHGPPARMGLPQPLLENGNRGVPVPPQPQLPVNTSKIKVGQ-GAAPPHTAQHQQPQPL 437 Query: 483 PQPPVYSSPTATTRNP 530 P PV P+A P Sbjct: 438 PMQPVQQQPSAQQPQP 453 >SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1002 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 Query: 405 STPTTTFGQRNNIPDHQPYYEDNLPSPQPPVYSSPTATT 521 STP T G D P + PS QPP +S T TT Sbjct: 177 STPNTAGGITGQ--DRAPIPPSSSPSAQPPTTTSTTTTT 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,744,019 Number of Sequences: 59808 Number of extensions: 515164 Number of successful extensions: 1715 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -