BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0836 (637 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CBF25 Cluster: hypothetical protein TTHERM_0031... 33 7.6 >UniRef50_UPI00006CBF25 Cluster: hypothetical protein TTHERM_00310160; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00310160 - Tetrahymena thermophila SB210 Length = 419 Score = 32.7 bits (71), Expect = 7.6 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +1 Query: 4 ERGGRLCLFVARCAFSLALQALNGTPQFFRACSRLHRIIRRCHVKNVTKNTSNCGR*YQI 183 ER LCL A Q L + + SR+ + +NV K +NC + +++ Sbjct: 35 ERFSNLCLKKDVAADQQEQQKLQNSSENINF-SRVQETQNIINNQNVKKKNNNCSKLFRV 93 Query: 184 KRTFNYKDKC 213 +TF+Y + C Sbjct: 94 SKTFSYPENC 103 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,275,022 Number of Sequences: 1657284 Number of extensions: 11349601 Number of successful extensions: 20258 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20256 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47296372782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -