BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0834 (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 26 0.35 S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 23 1.9 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.5 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.8 bits (54), Expect = 0.35 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +2 Query: 386 WKISNHTLEIQTMLEKIILYSVKLRAVIYIVITVIYSPKLSQGKNLTKSQLSQH 547 W + H EI TML ++ ++ + V+YI+I + KL + + LT + H Sbjct: 215 WTLIEHAFEISTMLFFVLPMTIII--VLYILIAI----KLRRSRMLTATVNRNH 262 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 455 VLLNTKLFFLTLSVFLKCDLKSSKSSQHLTSKCC 354 V+L T +F+T ++ +KC+ K H+ K C Sbjct: 14 VILITS-YFVTPTMSIKCNCKRHVIKPHICRKIC 46 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 552 PQCCDSWLFVRFFPWLNF 499 P CC S V F WL + Sbjct: 354 PDCCPSDRMVYFITWLGY 371 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 552 PQCCDSWLFVRFFPWLNF 499 P CC S V F WL + Sbjct: 354 PDCCPSDRMVYFITWLGY 371 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 552 PQCCDSWLFVRFFPWLNF 499 P CC S V F WL + Sbjct: 354 PDCCPSDRMVYFITWLGY 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,518 Number of Sequences: 438 Number of extensions: 2598 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -