BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0833 (791 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 24 6.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 8.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.2 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 392 LYNTVSLLISSRILTGLFGHRRKHRVRSLWAR 297 + NTVS+L++ I+ F R HR+ +W R Sbjct: 304 IMNTVSILVTVIIINWNFRGPRTHRM-PMWIR 334 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 219 LLSLLSRDESHCARRLDM 272 L S+L DE CARR+ M Sbjct: 233 LKSILRLDEDQCARRMAM 250 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 8.2 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +1 Query: 289 RECRAH--NDRTRCLRRCPK 342 R+C H D C+R+CPK Sbjct: 263 RKCPEHLLKDNGACVRKCPK 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,057 Number of Sequences: 2352 Number of extensions: 16943 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -