BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0832 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 164 6e-41 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 5.3 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 28 7.0 SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) 28 9.3 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 164 bits (399), Expect = 6e-41 Identities = 74/84 (88%), Positives = 78/84 (92%) Frame = +1 Query: 1 ARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEV 180 ARGPKKH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G EV Sbjct: 426 ARGPKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEV 485 Query: 181 LKIVKQRLIKVDGKVRTDPTYPAG 252 KIVKQRLIK+DGKVRTD TYPAG Sbjct: 486 KKIVKQRLIKIDGKVRTDTTYPAG 509 Score = 132 bits (318), Expect = 4e-31 Identities = 60/92 (65%), Positives = 72/92 (78%) Frame = +3 Query: 255 MDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRT 434 MDVV+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V+RV G K VPY+VTHD RT Sbjct: 511 MDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRVDVGAKGVPYIVTHDART 570 Query: 435 IRYPDPLIKVNDSIQLDIATTKIMDSSSLSPG 530 IRYPDP IKVND++ +DI T K++D G Sbjct: 571 IRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTG 602 Score = 124 bits (299), Expect = 8e-29 Identities = 50/75 (66%), Positives = 64/75 (85%) Frame = +2 Query: 509 FIKFESGNLCMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFIIGKG 688 +IKF++GN+ M+ GGRN+GRVG + RE+H GSFDIVH+KD+TGH FATRL N+F+IGKG Sbjct: 596 YIKFDTGNMAMVVGGRNMGRVGMVTHREKHAGSFDIVHVKDATGHQFATRLTNIFVIGKG 655 Query: 689 TKAYISLPRGKGXRL 733 K Y+SLP+GKG RL Sbjct: 656 NKPYVSLPKGKGVRL 670 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +3 Query: 141 EES--SEVCFDRKRSPENCE 194 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +3 Query: 240 LSCWIMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVT 419 L W+ S K N ++ I D+ R I +TP+ K C+V R++TGP +++ Sbjct: 261 LGGWVATRASGMKKN-VYGNIEDIIVR--IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMG 317 Query: 420 HDG 428 +G Sbjct: 318 SEG 320 >SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5) Length = 203 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 140 RKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAF-KRFKCFLGPR 3 RK +R N++G ++GLG+ PP + I F K K F PR Sbjct: 60 RKRSRSLPRTNVFGTLNGLGSPPPPRDNRIDEYAEFTKSQKSFTFPR 106 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -3 Query: 218 PSTFMRRCFTIFRTSFPVKAYFRRFLRK------ITRGKHSRNLW 102 PS++ F +FRT FP + RF R+ IT ++LW Sbjct: 84 PSSYNGHQFLVFRTDFPFSKHKNRFKRRTKYLYVITTSTKHQHLW 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,469,868 Number of Sequences: 59808 Number of extensions: 624787 Number of successful extensions: 1864 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1858 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -