BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0831 (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 5.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 319 LFDLLKDNRSMGFAXGTL 266 L DL+K NR++G A G + Sbjct: 748 LIDLMKKNRNLGAACGRI 765 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 319 LFDLLKDNRSMGFAXGTL 266 L DL+K NR++G A G + Sbjct: 748 LIDLMKKNRNLGAACGRI 765 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 319 LFDLLKDNRSMGFAXGTL 266 L DL+K NR++G A G + Sbjct: 748 LIDLMKKNRNLGAACGRI 765 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 319 LFDLLKDNRSMGFAXGTL 266 L DL+K NR++G A G + Sbjct: 748 LIDLMKKNRNLGAACGRI 765 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 126 KIEKKCDALKKGNYVDSTHKFN*YYK 203 +++K + G YV H N YY+ Sbjct: 1095 EVDKPSQPCEPGQYVPDPHNCNAYYR 1120 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 121 YNVKSLTDSVDFKLRNDETFXTHLLLLWFEIIED 20 Y+ + V + RN+ETF L+ + IED Sbjct: 1176 YDGPLIRGEVHYLNRNEETFWNELIEQYLHPIED 1209 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 121 YNVKSLTDSVDFKLRNDETFXTHLLLLWFEIIED 20 Y+ + V + RN+ETF L+ + IED Sbjct: 1176 YDGPLIRGEVHYLNRNEETFWNELIEQYLHPIED 1209 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 390 SPHNRDSQNFIXTFYETRTNVSASSLI 310 +PH RDS N+I T ++S I Sbjct: 179 APHLRDSPNYIKPQLHVSTGSTSSPTI 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,209 Number of Sequences: 336 Number of extensions: 2406 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -