BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0830 (486 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 29 1.5 SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 336 DSINFQP--SPNFKHMXKYLKCKFWEESHSPQYHAVTEFPEAEAMEKKGDE 482 D +NF +P +KHM KY+K E+ + P+ E PE + E + ++ Sbjct: 196 DFLNFDNWLNPYYKHMLKYIK----EKRYEPKIQTQPESPEQQEEESEQED 242 >SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 335 RFY*FSAITEFQTYXKIFKMQVLGGESLAPIS 430 RF T+ +TY KIFK+ V GG + ++ Sbjct: 626 RFILDKQFTDVETYGKIFKLDVPGGFKIISVA 657 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,865,320 Number of Sequences: 59808 Number of extensions: 230765 Number of successful extensions: 375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -