BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0830 (486 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 25 1.8 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 25 1.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 5.6 AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. 23 5.6 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 22 9.7 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 22 9.7 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 318 QSIGDEDSINFQPSPNFKHMXKYLKC 395 Q GDE+ FQ + KH + +KC Sbjct: 151 QKFGDEEHYIFQHDNDSKHTSRTVKC 176 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 318 QSIGDEDSINFQPSPNFKHMXKYLKC 395 Q GDE+ FQ + KH + +KC Sbjct: 223 QQFGDEEHYIFQHDNDSKHTSRTVKC 248 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.0 bits (47), Expect = 5.6 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +3 Query: 327 GDEDSINFQPSPNFKHMXKYLKCKFWEESHSPQYHAVTE 443 GD+ S+ + NF + Y K W+ P Y V E Sbjct: 176 GDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYE 214 >AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. Length = 113 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -2 Query: 140 ILKSQ*AERRFVDKILLLLNKRDHTRLDL 54 +++S A +RF++ ++ ++K + LDL Sbjct: 83 LVRSSQARKRFIENVMKFIDKYNFDGLDL 111 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 22.2 bits (45), Expect = 9.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 5 ILNQTIEFIENLVLIFL 55 ILNQ ++FI N +FL Sbjct: 382 ILNQPVKFIANRPFLFL 398 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 22.2 bits (45), Expect = 9.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 356 WLKINRIFIPYTLEICLAC 300 WLK+ I +T E C+ C Sbjct: 302 WLKVVDCGIRWTCECCIEC 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,114 Number of Sequences: 2352 Number of extensions: 8256 Number of successful extensions: 64 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -