BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0830 (486 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 1.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 2.3 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 23.0 bits (47), Expect = 1.7 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 108 CR*DIIVIE*TRSYSARFKKINTKFSINSIV 16 C ++++ TR + + + KFS+NSI+ Sbjct: 272 CEPQVVIVSPTRELTIQIWQQIVKFSLNSIL 302 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 2.3 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 327 GDEDSINFQPSPNFKHMXKYLKCKFWEESHSPQY 428 GD+ S+ + NF + Y K W+ + P Y Sbjct: 176 GDQVSLALYNNKNFVDLSDYWKSGTWDIINVPAY 209 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 2.3 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 279 EINAXSDAGQ-TNFQSIGDEDSINFQPSPNFKH 374 E+ S+ G +N+Q+ G+ D +NF N ++ Sbjct: 160 ELEKQSEQGDVSNYQANGEFDLVNFSARRNVEY 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,648 Number of Sequences: 438 Number of extensions: 2541 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -