BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0830 (486 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53960.1 68416.m05961 proton-dependent oligopeptide transport... 28 2.9 At1g58602.1 68414.m06655 disease resistance protein (CC-NBS-LRR ... 27 6.7 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 27 8.9 At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR ... 27 8.9 >At3g53960.1 68416.m05961 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 602 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -2 Query: 182 NMLHEDLNQRLTKNILKSQ*AERRFVDKILLLLNKRDHTRLD 57 ++LHE N+ TK L S +F+DK ++ ++ ++T+ + Sbjct: 280 SLLHELTNEEYTKGRLLSSSKNLKFLDKAAVIEDRNENTKAE 321 >At1g58602.1 68414.m06655 disease resistance protein (CC-NBS-LRR class), putative similar to diesease resistance protein rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 1138 Score = 27.1 bits (57), Expect = 6.7 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 303 GQTNFQSIGDEDSINFQPSPNFKHMXKYLKCKFWEESHSPQYHAV 437 G+TNF + +S N+ S +F+ + YLK F +H P+ + + Sbjct: 401 GRTNFND-DNNNSCNYVLSLSFEELPSYLKHCFLYLAHFPEDYEI 444 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 26.6 bits (56), Expect = 8.9 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -2 Query: 278 FYPKKVTQHLEFLSQNNSHYKQSS*IERTST*NMLHEDLNQRLT--KNILKSQ*AERRF 108 F VT+H+EF+ + +++ E T+T +L RL KNIL+S E RF Sbjct: 3321 FSADAVTKHVEFVKEYKQDFERHLDPESTTTFPATLAELTARLKKWKNILQSN-VEDRF 3378 >At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 900 Score = 26.6 bits (56), Expect = 8.9 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 303 GQTNFQSIGDEDSINFQPSPNFKHMXKYLKCKFWEESHSPQYHAV 437 G+T+F S G+ S+ S +F+ + YLK F +H P+ H + Sbjct: 387 GRTDF-SDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNI 430 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,419,311 Number of Sequences: 28952 Number of extensions: 177258 Number of successful extensions: 370 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -