BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0829 (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z67882-3|CAA91800.2| 1324|Caenorhabditis elegans Hypothetical pr... 28 5.4 AC006714-10|AAK29727.2| 253|Caenorhabditis elegans F-box a prot... 28 5.4 AL033514-38|CAA22111.2| 341|Caenorhabditis elegans Hypothetical... 28 7.1 >Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical protein T03E6.6 protein. Length = 372 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 130 LVSAGYIIKGNTYLFNV*IRTLTIKSKMLVGILYTI 237 L S ++ GN Y FN +R++ + K + IL+T+ Sbjct: 303 LPSGIFLWLGNLYKFNTVVRSIVFEGKNVTSILFTV 338 >Z67882-3|CAA91800.2| 1324|Caenorhabditis elegans Hypothetical protein F22E10.2 protein. Length = 1324 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 5 PTVFLDFISVYVCRFKSSQQI*KYVPVDFL*TASFYT 115 P+VF F++ +CR S+Q+ ++ PV L F T Sbjct: 50 PSVFEKFVNFLLCRCDLSEQVLEFQPVSLLQLFRFAT 86 >AC006714-10|AAK29727.2| 253|Caenorhabditis elegans F-box a protein protein 21 protein. Length = 253 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 337 SNYLRCDDSSSFVILCSDYFINKSL 263 +N++ DSSSF I+C YF +L Sbjct: 220 NNFIHSFDSSSFRIICDHYFYGNTL 244 >AL033514-38|CAA22111.2| 341|Caenorhabditis elegans Hypothetical protein Y75B8A.33 protein. Length = 341 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 76 RTSRFFVNCQFLYYSCKLLVSAGYIIKGNTYL 171 + R F+N F + LLV + IK NTY+ Sbjct: 11 KRQRLFINVSFFFLIIGLLVLGVFTIKKNTYI 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,800,106 Number of Sequences: 27780 Number of extensions: 254462 Number of successful extensions: 440 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -