BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0828 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 26 0.32 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 24 1.3 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 23 3.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.1 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 26.2 bits (55), Expect = 0.32 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 234 AGPNTHFGGVQLGFFNSS 181 +GP GGV+LG+FN S Sbjct: 55 SGPEESSGGVELGWFNDS 72 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 332 YNVRGRTASSVKPSHSSQMR*EAYPMCCREQSK 234 Y RGR +S ++ S S + E MCC+E + Sbjct: 51 YACRGRCSSYLQVSGSKIWQMERSCMCCQESGE 83 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 22.6 bits (46), Expect = 3.9 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -3 Query: 289 IPPR*GKRHIPCAVENSPSWTKYPLWGSPAWLL*LIIPGLFTVVFTDLTR-KEQSIGP 119 +P GK PC ++ P WT + LIIPG ++ T T E+ GP Sbjct: 28 LPSWDGKMPQPCILKPKPLWTGKQISS-------LIIPGNVNMIRTHSTXPXEEDDGP 78 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 9.1 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +2 Query: 173 SWYDELKKPSWTPPKWVFGPAWTVLYSTWDMPLTSSGRNVMVLLKMQSYLSHCTEY 340 SW KP P + G + ST +S V L + +++S CT + Sbjct: 262 SWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQASLPPVSYLKAVDAFMSVCTVF 317 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/36 (19%), Positives = 18/36 (50%) Frame = +2 Query: 218 WVFGPAWTVLYSTWDMPLTSSGRNVMVLLKMQSYLS 325 W+FG W ++ D+ + ++ + + + YL+ Sbjct: 131 WIFGDLWCSIWLAVDVWMCTASILNLCAISLDRYLA 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,416 Number of Sequences: 438 Number of extensions: 5161 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -