BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0821 (740 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61460.1 68418.m07712 structural maintenance of chromosomes (... 28 5.7 At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.7 At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.7 At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.7 At1g55110.1 68414.m06294 zinc finger (C2H2 type) family protein ... 28 5.7 At1g09010.1 68414.m01005 glycoside hydrolase family 2 protein lo... 28 5.7 At1g78650.1 68414.m09166 expressed protein weak similarity to DN... 28 7.5 At1g54920.2 68414.m06269 expressed protein 27 9.9 >At5g61460.1 68418.m07712 structural maintenance of chromosomes (SMC) family protein very strong similarity to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1057 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 609 GDNMVVVVNAVHRNNLRFRKQAVG 538 GD ++ ++ A+ RN+ RFRK +G Sbjct: 454 GDRVINLLQAIERNHRRFRKPPIG 477 >At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 462 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +1 Query: 292 VLDNTQQNTRQDYSFYERSNVIASSKFATPKRVETIASINKRDINTTALPASP 450 VLD T T Y FY + F P ET N +DI T +P P Sbjct: 125 VLDITADFTFPVYFFYTSGAACLAFSFYLPTIDETTPGKNLKDIPTVHIPGVP 177 >At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 446 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +1 Query: 292 VLDNTQQNTRQDYSFYERSNVIASSKFATPKRVETIASINKRDINTTALPASP 450 VLD T T Y FY + F P ET N +DI T +P P Sbjct: 125 VLDITADFTFPVYFFYTSGAACLAFSFYLPTIDETTPGKNLKDIPTVHIPGVP 177 >At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 451 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +1 Query: 292 VLDNTQQNTRQDYSFYERSNVIASSKFATPKRVETIASINKRDINTTALPASP 450 VLD T T Y FY + F P ET N +DI T +P P Sbjct: 125 VLDITADFTFPVYFFYTSGAACLAFSFYLPTIDETTPGKNLKDIPTVHIPGVP 177 >At1g55110.1 68414.m06294 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 455 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 78 HLKHHESSQVFGFRSSTQNI 19 H HH++ Q GF SS+QNI Sbjct: 241 HHHHHQTQQNIGFSSSSQNI 260 >At1g09010.1 68414.m01005 glycoside hydrolase family 2 protein low similarity to mannosidase [gi:5359712] from Cellulomonas fimi Length = 944 Score = 28.3 bits (60), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 382 WESQIWTKLSHLIVHKNYN 326 W SQ+WTK + +++ KN N Sbjct: 640 WSSQMWTKYTGVLIWKNQN 658 >At1g78650.1 68414.m09166 expressed protein weak similarity to DNA polymerase delta subunit 3 (DNA polymerase delta subunit p66) (Swiss-Prot:Q15054) [Homo sapiens] Length = 509 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +1 Query: 244 SEPLGKSRPVGAIESFVLDNTQQNTRQDYSFYERSNVIASSKFATPK--RVETIASINKR 417 SE G +P + + + +++D ++V AS+ +T K + + A +N Sbjct: 344 SEDSGPEKPDADVSPEIKSEEPEASKEDRQ--NTASVDASTTLSTEKIQAIGSEAEVNPS 401 Query: 418 DINTTALPASPTR 456 TTA+P+SP R Sbjct: 402 KRRTTAVPSSPKR 414 >At1g54920.2 68414.m06269 expressed protein Length = 890 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +1 Query: 193 KKSRGWN*AGARGYNFGSEPLGKSRPVGAIESFVLDNTQQNTRQDYSFYERSNV 354 K+S GW G+ FG EP+ K + +S V T++ SF +V Sbjct: 303 KESNGW------GFGFGFEPVSKLETTNSFQSSVEKETKKMENGSISFPSNGDV 350 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,191,050 Number of Sequences: 28952 Number of extensions: 309171 Number of successful extensions: 780 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -