BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0816 (453 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 4e-24 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 4e-24 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 64 5e-11 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 64 5e-11 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 58 3e-09 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 55 3e-08 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-08 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 54 7e-08 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 52 3e-07 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 51 4e-07 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 49 2e-06 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 48 4e-06 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 48 5e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 47 8e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 42 2e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 40 0.001 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.027 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.34 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 0.78 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 30 1.0 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 29 2.4 SB_17830| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) 28 4.2 SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 28 4.2 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 27 5.5 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 27 5.5 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.5 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.5 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 27 5.5 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 27 7.3 SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 107 bits (257), Expect = 4e-24 Identities = 53/78 (67%), Positives = 65/78 (83%), Gaps = 6/78 (7%) Frame = +2 Query: 236 TRNNALLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE------CQALILAPTRXLAQ 397 T+N+ +L RDVIAQAQSGTGKTATF+ISILQ+IDT+ ++ CQAL+LAPTR LAQ Sbjct: 114 TKNHYVLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQ 173 Query: 398 QIQKVVIALGDXLNAKCH 451 QIQKVV+ALGD ++ KCH Sbjct: 174 QIQKVVLALGDYMHVKCH 191 Score = 85.4 bits (202), Expect = 2e-17 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 Query: 117 GTLDTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCSKD 263 G ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQRAI PC ++ Sbjct: 52 GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQE 100 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 107 bits (257), Expect = 4e-24 Identities = 50/67 (74%), Positives = 60/67 (89%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALGD 430 +L+GRDVIAQAQSGTGKTATFSIS+LQ IDT +RE QAL+L+PTR LA QIQKVV+ALGD Sbjct: 31 ILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGD 90 Query: 431 XLNAKCH 451 ++ +CH Sbjct: 91 YMSVQCH 97 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 207 GFEKPSAIQQRAIMPCSK 260 GFEKPSAIQQRAI P K Sbjct: 16 GFEKPSAIQQRAIKPILK 33 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 64.1 bits (149), Expect = 5e-11 Identities = 29/64 (45%), Positives = 45/64 (70%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALGDX 433 L GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTR LA Q ++ I LG Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 Query: 434 LNAK 445 + A+ Sbjct: 142 MGAQ 145 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D LK ELL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 64.1 bits (149), Expect = 5e-11 Identities = 29/64 (45%), Positives = 45/64 (70%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALGDX 433 L GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTR LA Q ++ I LG Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 Query: 434 LNAK 445 + A+ Sbjct: 142 MGAQ 145 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D LK ELL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 58.0 bits (134), Expect = 3e-09 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALG 427 G D+IAQA+SGTGKT FS+ L+ + T Q +IL PTR +A Q++ V+ A+G Sbjct: 50 GLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIG 105 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F + L LLRG+ GFEKPS IQ +AI Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAI 44 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 54.8 bits (126), Expect = 3e-08 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +2 Query: 263 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALGDXLNA 442 +DVI A++G+GKT F++ ILQ + + + ALIL PTR LA QI + ALG + Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGV 61 Query: 443 KC 448 KC Sbjct: 62 KC 63 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 54.4 bits (125), Expect = 4e-08 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE--CQALILAPTRXLAQQIQKVVIAL 424 ++ G+DV+A A++G+GKTA F I + +++ T + +ALIL+PTR LA Q QK + L Sbjct: 315 VMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKEL 374 Query: 425 G 427 G Sbjct: 375 G 375 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 53.6 bits (123), Expect = 7e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +2 Query: 347 IRECQALILAPTRXLAQQIQKVVIALGDXLNAKCH 451 +RE QAL+L+PTR LA QIQKVV+ALGD ++ +CH Sbjct: 1 LREPQALVLSPTRELANQIQKVVLALGDYMSVQCH 35 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 51.6 bits (118), Expect = 3e-07 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = +2 Query: 266 DVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALG 427 ++IAQ+QSGTGKTA F +++L ++D + Q + L+PT LA+Q KV A+G Sbjct: 144 NMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMG 197 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 150 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 ++F+++ L L RG+Y GF KPS IQ+ A+ Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQETAL 134 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 51.2 bits (117), Expect = 4e-07 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQKVVIALGD 430 +LQGRD I A++G+GKTA F++ ILQ++ A++L PTR LA QI LG Sbjct: 41 ILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGR 100 Query: 431 XLNAK 445 + K Sbjct: 101 PIGLK 105 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 49.2 bits (112), Expect = 2e-06 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 9/73 (12%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISIL---------QQIDTSIRECQALILAPTRXLAQQIQ 406 LQ RD+I A++G+GKTA F+I +L ++ + + + ALILAPTR LAQQI+ Sbjct: 136 LQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIE 195 Query: 407 KVVIALGDXLNAK 445 + ++ G L + Sbjct: 196 EEILKFGRPLGIR 208 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 48.0 bits (109), Expect = 4e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQK 409 G D+I QA+SG GKTA F ++ LQQ++ + L++ TR LA QI K Sbjct: 84 GMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHK 133 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F D LK ELLR I GFE PS +Q I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECI 78 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 48.0 bits (109), Expect = 4e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRXLAQQIQK 409 G D+I QA+SG GKTA F ++ LQQ++ + L++ TR LA QI K Sbjct: 84 GMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHK 133 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F D LK ELLR I GFE PS +Q I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECI 78 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 47.6 bits (108), Expect = 5e-06 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQ----QIDTSIRECQALILAPTRXLAQQIQKVVIA 421 L GRDV+ A++G+GKT F I I++ Q TS+ AL+++PTR LA Q +V++ Sbjct: 85 LSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVK 144 Query: 422 LGD 430 +G+ Sbjct: 145 IGN 147 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 46.8 bits (106), Expect = 8e-06 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 6/78 (7%) Frame = +2 Query: 233 ATRNNALLQGRDVIAQAQSGTGKTATFSISILQQI-DTSI-----RECQALILAPTRXLA 394 A+ N + G DVI QA++GTGKT +F++ +++++ D + R + L++APTR LA Sbjct: 101 ASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELA 160 Query: 395 QQIQKVVIALGDXLNAKC 448 +Q+ L L C Sbjct: 161 KQVGNEFENLKSNLEVYC 178 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 43.6 bits (98), Expect = 8e-05 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISIL-----QQIDTSIRECQALILAPTRXLAQQI 403 ++ GRD++A AQ+G+GKTA + + +L Q ++ R AL +APTR LA+QI Sbjct: 513 VMAGRDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQI 568 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 42.3 bits (95), Expect = 2e-04 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQI---DTSIRECQALILAPTRXLAQQ 400 L G+DV A A +GTGKTA F + IL+++ T + L++ PTR LA Q Sbjct: 45 LMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.5 bits (93), Expect = 3e-04 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 9/60 (15%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQI------DTSIREC---QALILAPTRXLAQQI 403 ++ GRDV+A AQ+G+GKTA F + ++ + +S E QA+ +APTR LA QI Sbjct: 745 VIAGRDVMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQI 804 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 40.3 bits (90), Expect = 7e-04 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATF----SISILQQIDTSIRECQ-ALILAPTRXLAQQIQKVVI 418 L GRD+I A++G+GKTA F + I+ Q + + + LI APTR L QQI Sbjct: 552 LSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEAR 611 Query: 419 ALGDXLN 439 G N Sbjct: 612 RFGKAYN 618 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = +2 Query: 245 NALLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ-----ALILAPTRXLAQQI 403 + ++ GRD+I A++G+GKT +S+ + + T ALIL PTR L QQ+ Sbjct: 104 SCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 132 DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 D + +E+F D+NL EL + F+ P+ IQ +++ Sbjct: 66 DCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSL 103 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 37.5 bits (83), Expect = 0.005 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 19/85 (22%) Frame = +2 Query: 248 ALLQGRDVIAQAQSGTGKTATFSISILQQIDT--------------SIRECQ-----ALI 370 ALL RD+I A++G+GKT F I I+Q I+ S E Q ALI Sbjct: 164 ALLYHRDIIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALI 223 Query: 371 LAPTRXLAQQIQKVVIALGDXLNAK 445 +APTR LA Q++ ++ + K Sbjct: 224 MAPTRELALQVKDHLVKAAKYTSVK 248 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATF---SISILQQIDTSIRE-CQALILAPTRXLAQQ 400 LL+GRD++ A++G+GKT F + +L ++ R +I++PTR L+ Q Sbjct: 606 LLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQ 659 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 263 RDVIAQAQSGTGKTATFSISILQQI 337 RD++A AQ+G+GKTA F I IL +I Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRI 937 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D++L E LL + G++KP+ +Q+ AI Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAI 906 >SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 32.7 bits (71), Expect = 0.15 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +3 Query: 27 ERRSEDWPEDSKNGPSKDQGSYD---GPPGMDPGTLDTDWDQVVETFDDMNLKEELLRGI 197 E+ +E+ E +K + D+G GPPG GT D VVE DD K E G Sbjct: 19 EKTAEEMRELAKKAEACDRGVRAILLGPPGSGKGTQLVSDDLVVELIDDNLTKPECQNGW 78 Query: 198 YAYGFEKPSA 227 GF + A Sbjct: 79 LLDGFPRTVA 88 >SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1750 Score = 31.5 bits (68), Expect = 0.34 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 2/92 (2%) Frame = -1 Query: 351 RMLVSICCRIDIEKVAVFPVPDWA*AITSRPWSKALLRVAGLQKVFQNHR-RICLSTILL 175 R+ VS+ C ++ + FP+PD + RPW K +R L VF + + + Sbjct: 652 RLNVSLSCP-ELSVMLRFPIPDLRPVVERRPWWKQAVRDESLLLVFSAFKFNTVVCSADP 710 Query: 174 *GSCHRRFRQLDP-SRCQVSQGPFPEVHRNYL 82 S RF+Q+D + P P +H + L Sbjct: 711 AASYELRFQQMDGYYKESAGATPIPVMHSSPL 742 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 365 LILAPTRXLAQQIQKVVIALG 427 L+L PTR LAQQ+Q+V ++G Sbjct: 136 LVLCPTRELAQQVQEVAYSVG 156 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 248 ALLQGRDVIAQAQSGTGKTATFSISILQQIDTS 346 +LL+GRDV A G+GK + + I+ QI S Sbjct: 220 SLLRGRDVAGVAIEGSGKRLAYLLPIIHQITES 252 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 66 GPSKDQG-SYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELLRG 194 GP +QG S GPPG PG T W+ + N E LRG Sbjct: 3363 GPKGEQGRSISGPPG-PPGAPGTSWNDSIVNGGLSNSLLESLRG 3405 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGP 101 +M Y SER P D P+ D GS D P Sbjct: 1171 SMEYDSERHPYQAPADEMVNPNTDGGSRDNP 1201 >SB_17830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 293 FLTGLER*HRVLGARHYCALLDCRRFFKTIGVYASQQFFFEVH 165 FLT R +++ RH C D F K Y +FFF+VH Sbjct: 80 FLTFATRLYKLSEPRHIC--WDETHFGKHANFYIKGEFFFDVH 120 >SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) Length = 532 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE 355 + G DV+A + SGT K + F ++++ D+ R+ Sbjct: 245 VNGSDVVANSSSGTVKRSLFLPEVMEENDSVFRD 278 >SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 51 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 182 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 71 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 111 >SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 51 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 182 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 54 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 94 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 203 GVYASQQFFFEVHVIEGFDNLIPVGVKC 120 GVY F H + GF N IP +C Sbjct: 742 GVYLESNVFQNGHALVGFQNTIPASQEC 769 >SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) Length = 618 Score = 27.5 bits (58), Expect = 5.5 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 4/113 (3%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELL 188 N SYSS + EDW + ++ P +G P P +L T +++E N+ E L Sbjct: 265 NQSYSSGQLPEDWTK-AQVVPIFKKGVKHDPCNYRPVSLTTVLCKLMEHVIYKNIMEHLE 323 Query: 189 RG--IYA--YGFEKPSAIQQRAIMPCSKDAMLSLKPSQELEKLLLSLYRFYNK 335 ++A +GF K + + + ++ +D + +++ L+L + ++K Sbjct: 324 NNNILFANQHGFRKNHSCETQLLLTV-EDLARNTDNGGQIDMLILDFSKAFDK 375 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 27.5 bits (58), Expect = 5.5 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 4/113 (3%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELL 188 N SYSS + EDW + ++ P +G P P +L T +++E N+ E L Sbjct: 83 NQSYSSGQLPEDWTK-AQVVPIFKKGVKHDPCNYRPVSLTTVLCKLMEHVIYKNIMEHLE 141 Query: 189 RG--IYA--YGFEKPSAIQQRAIMPCSKDAMLSLKPSQELEKLLLSLYRFYNK 335 ++A +GF K + + + ++ +D + +++ L+L + ++K Sbjct: 142 NNNILFANQHGFRKNHSCETQLLLTV-EDLARNTDNGGQIDMLILDFSKAFDK 193 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 27.5 bits (58), Expect = 5.5 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 4/113 (3%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELL 188 N SYSS + EDW + ++ P +G P P +L T +++E N+ E L Sbjct: 83 NQSYSSGQLPEDWTK-AQVVPIFKKGVKHDPCNYRPVSLTTVLCKLMEHVIYKNIMEHLE 141 Query: 189 RG--IYA--YGFEKPSAIQQRAIMPCSKDAMLSLKPSQELEKLLLSLYRFYNK 335 ++A +GF K + + + ++ +D + +++ L+L + ++K Sbjct: 142 NNNILFANQHGFRKNHSCETQLLLTV-EDLARNTDNGGQIDMLILDFSKAFDK 193 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 27.5 bits (58), Expect = 5.5 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 4/113 (3%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELL 188 N SYSS + EDW + ++ P +G P P +L T +++E N+ E L Sbjct: 83 NQSYSSGQLPEDWTK-AQVVPIFKKGVKHDPCNYRPVSLTTVLCKLMEHVIYKNIMEHLE 141 Query: 189 RG--IYA--YGFEKPSAIQQRAIMPCSKDAMLSLKPSQELEKLLLSLYRFYNK 335 ++A +GF K + + + ++ +D + +++ L+L + ++K Sbjct: 142 NNNILFANQHGFRKNHSCETQLLLTV-EDLARNTDNGGQIDMLILDFSKAFDK 193 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKT 304 ++ GRDV+A AQ+G+GKT Sbjct: 168 VIAGRDVMACAQTGSGKT 185 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 9/67 (13%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQ---------IDTSIRECQALILAPTRXLAQQI 403 ++ VI AQ+G+GKT + ++ + I ++ +A I+ P R LA QI Sbjct: 412 IIHRHHVICAAQTGSGKTLAYLAPLVHRLREDEERHGILARLKRPRACIVVPARELATQI 471 Query: 404 QKVVIAL 424 K +L Sbjct: 472 LKTAKSL 478 >SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 27.1 bits (57), Expect = 7.3 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 7/37 (18%) Frame = +3 Query: 63 NGPSKDQGSYDGPPGMDPGTLD-------TDWDQVVE 152 NGP+ D YD PP P T D T+WD ++ Sbjct: 340 NGPTSDNTDYDSPPRATP-TYDAPTRSTRTNWDPTID 375 >SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 448 AFSIQXITKXYHHLLNLLGQLSCGSQDQSLTFTNACID 335 A ++Q +TK Y HL+N+ G +++ T C D Sbjct: 201 AHALQTLTKAYRHLMNVTGN---RDKEEKANATEQCAD 235 >SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4085 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 51 EDSKNGPSKDQGSYDGPPGMDP 116 +DSK P D+ PPG DP Sbjct: 4012 KDSKTNPKSDKTQIGQPPGADP 4033 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,486,863 Number of Sequences: 59808 Number of extensions: 305297 Number of successful extensions: 1590 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1585 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -