BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0813 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0052 + 14101886-14102117,14104271-14104422,14104545-141048... 28 9.3 >03_03_0052 + 14101886-14102117,14104271-14104422,14104545-14104818, 14104926-14105098 Length = 276 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -3 Query: 735 ILSMDMVEINDDSIDRYQLLFVFNPIITVKYDPLVPLSTYKNNSSIDLTINL 580 I+S + + + + Y LF N T + PLVP T K ++I + INL Sbjct: 82 IMSKSLFLMEEIGGNDYGYLFTQNRSFTKEIKPLVPKVTAKIENAIKVLINL 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,413,790 Number of Sequences: 37544 Number of extensions: 283536 Number of successful extensions: 451 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -