BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0813 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39680.1 68415.m04868 expressed protein 31 0.83 At5g63930.1 68418.m08028 leucine-rich repeat transmembrane prote... 28 5.9 >At2g39680.1 68415.m04868 expressed protein Length = 84 Score = 31.1 bits (67), Expect = 0.83 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = -1 Query: 386 CFL*QLWS*SGLVFCLISNSY*Y*LK*FYSKFKSNRINIFVT----IHIC 249 C L Q S S L+FC+ SN+Y LK + S +S R+ F T HIC Sbjct: 5 CLLKQRLSRSILLFCIYSNTY-MGLKTYVSTIRSTRVTTFFTGIRLKHIC 53 >At5g63930.1 68418.m08028 leucine-rich repeat transmembrane protein kinase, putative Length = 1102 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -3 Query: 699 SIDRYQLLFVFNPIITVKYDPLVPLSTYKNNSSIDLTINLEHCKIPFNLYF 547 +I+ +LL++F +T V LST KN S +DL+IN IP + Sbjct: 335 NIEGLELLYLFENQLTGTIP--VELSTLKNLSKLDLSINALTGPIPLGFQY 383 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,292,208 Number of Sequences: 28952 Number of extensions: 266932 Number of successful extensions: 465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -