BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0811 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 6e-21 SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) 59 3e-09 SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_6989| Best HMM Match : LRR_1 (HMM E-Value=0.074) 32 0.44 SB_3502| Best HMM Match : zf-DBF (HMM E-Value=4.9) 30 1.8 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) 29 3.1 SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) 29 3.1 SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) 29 3.1 SB_57495| Best HMM Match : G_glu_transpept (HMM E-Value=0) 29 4.1 SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) 29 4.1 SB_14491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) 29 5.5 SB_20667| Best HMM Match : Amelogenin (HMM E-Value=8.5) 29 5.5 SB_19477| Best HMM Match : GST_C (HMM E-Value=0.64) 29 5.5 SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) 29 5.5 SB_12710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) 28 9.5 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 98.3 bits (234), Expect = 6e-21 Identities = 52/93 (55%), Positives = 64/93 (68%), Gaps = 8/93 (8%) Frame = +1 Query: 268 PKLRKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGL 447 P ++D T EL++YDG + VLMAVNG +FDVTRG FYGPGGPY+ F G DA+RGL Sbjct: 55 PFKKRDFTLDELKEYDGLKSP-YVLMAVNGKVFDVTRGKDFYGPGGPYSNFAGHDASRGL 113 Query: 448 ATFSV--TAPEKDYDDLSDLNS------RKWNQ 522 ATFS+ A + +YDDLSDLN R+W Q Sbjct: 114 ATFSLGPEAIKDEYDDLSDLNGMQQDSLREWEQ 146 Score = 58.0 bits (134), Expect = 8e-09 Identities = 25/42 (59%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +3 Query: 510 EMESVREWEEQFRENYDLVGRLLRPGEEPRNY-SDEEPEEAD 632 + +S+REWE+QF E YDLVGRLL+PGE+ + Y ++EE EE D Sbjct: 137 QQDSLREWEQQFDEKYDLVGRLLKPGEKHQQYETEEETEEED 178 >SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 64.9 bits (151), Expect = 7e-11 Identities = 34/80 (42%), Positives = 47/80 (58%), Gaps = 5/80 (6%) Frame = +1 Query: 280 KDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 459 ++ T EL+ YDG + + +AVNG +FDVT ++GP GP + G+DA+R L TFS Sbjct: 72 REFTVRELKGYDGVNKE-LIYVAVNGKVFDVTSAWNYFGPAGPDCLLAGKDASRALVTFS 130 Query: 460 V-----TAPEKDYDDLSDLN 504 V T DDL+DLN Sbjct: 131 VDNFYQTEQRDSMDDLNDLN 150 >SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/61 (40%), Positives = 39/61 (63%) Frame = +1 Query: 286 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 465 ++ V+L ++DG Q + +A+ G ++DV +G RFYGPG Y VF GRD+T T V+ Sbjct: 272 LSTVDLVKHDGLQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVTVLVS 331 Query: 466 A 468 + Sbjct: 332 S 332 >SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) Length = 310 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/74 (37%), Positives = 44/74 (59%) Frame = +1 Query: 286 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 465 ++ +L ++DG+Q + +A+ G ++DV +G RFYGPG Y VF GRD+T T + Sbjct: 88 LSTEDLAKHDGSQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVT-GMF 146 Query: 466 APEKDYDDLSDLNS 507 K DD S+L + Sbjct: 147 DRAKATDDCSNLKN 160 >SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = +1 Query: 262 KLPKLRKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATR 441 K+ K T EL ++G + +AV G +FDV+ YG G Y G++ +R Sbjct: 40 KITPGHKLFTKDELATFNGRNSNSPIYVAVKGVVFDVSTSKDLYGYGESYNSMAGKECSR 99 Query: 442 GLATFSVTA 468 +A +S+ A Sbjct: 100 AIAKWSLAA 108 >SB_6989| Best HMM Match : LRR_1 (HMM E-Value=0.074) Length = 180 Score = 32.3 bits (70), Expect = 0.44 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = -1 Query: 332 PPSCVPSYCRSSTAVISFRNLG----SFFKEQPLNNVSYTCSKIYTVSQM-YSQKQNK*T 168 PP CV YC +S VI+ R L S P++ +S + +YT S+ +++ K Sbjct: 9 PPPCVGFYCEASPRVITIRTLNAHGWSNTATDPVSRLSLYHTSVYTQSRFDFNRAHQKMA 68 Query: 167 VDKTV 153 +KT+ Sbjct: 69 WEKTL 73 >SB_3502| Best HMM Match : zf-DBF (HMM E-Value=4.9) Length = 476 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 600 NYSDEEPEEADTSALPNDDKKTNLN 674 NY+D PE+ D+S LP+ T LN Sbjct: 12 NYTDRSPEDYDSSPLPSSAVSTELN 36 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + A +LC +LP Y + S++ F G + + C Sbjct: 610 SNHAEYVVYRQNVVRARVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 657 >SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + +++LC +LP Y + S++ F G + + C Sbjct: 337 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 384 >SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) Length = 390 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + +++LC +LP Y + S++ F G + + C Sbjct: 307 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 354 >SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) Length = 317 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 234 SNHAEYLVYRQNVARSRVLCATLLPVVYSVSLVSRYNELFTGRSLQSC 281 >SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) Length = 438 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 355 SNHAEYVVYRQNMVRSRVLCAALLPVVYSVSLDSRYNELFTGRSLQSC 402 >SB_57495| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 761 Score = 29.1 bits (62), Expect = 4.1 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Frame = +3 Query: 582 PGEEPRNYSDEEPEEADTSALPNDDKKTNLNFHCQMTVALPSKI----DQFVEHFASHLH 749 PG R S+ + E +D L K+ N + C++ P ++ DQ VE F+ LH Sbjct: 646 PGSMTRLLSELDVESSDDEFL--QPKQENKSACCRVVKGRPIEVKPFRDQEVESFSPGLH 703 Query: 750 SLIG 761 L+G Sbjct: 704 DLVG 707 >SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 235 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 86 C I+ + F+QY CT + T +C +K + G+HI +L W +H Sbjct: 477 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 524 >SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) Length = 511 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 235 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 86 C I+ + F+QY CT + T +C +K + G+HI +L W +H Sbjct: 407 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 454 >SB_14491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 298 LLRSYLFAI*VVFSRSNL*TMCLILVVKFIQYHKCTHKNKINKRLTKQCF 149 L R Y + +S SNL + L + K + HKC NK++ +TK F Sbjct: 3 LTRMYAEDTTITYSASNLVELELQINSKLSKLHKCLLANKLSLNITKTEF 52 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 813 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 860 >SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) Length = 580 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 444 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 491 >SB_20667| Best HMM Match : Amelogenin (HMM E-Value=8.5) Length = 168 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 595 PGTTRTKNPKKQTRPLSPTTTR 660 P TTR +NP P SPTTT+ Sbjct: 115 PQTTRQQNPPTINAPTSPTTTK 136 >SB_19477| Best HMM Match : GST_C (HMM E-Value=0.64) Length = 1294 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 510 EMESVREWEEQFRENYDLVGRLLRPGEEPRNYSD 611 E + V R Y +G++++PGE+PR + Sbjct: 665 EQDQVSRRTATLRSTYSRLGKIVKPGEQPRKVGE 698 >SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) Length = 511 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + +++LC +LP Y + S++ F G + + C Sbjct: 330 SNHAEYVVHRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 377 >SB_12710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 537 EQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKKTN 668 EQF +DLVG +L S+EE E+ +P ++ KTN Sbjct: 19 EQFLPAFDLVGTILTTSRNISILSEEEVEKRKDDRIP-ENTKTN 61 >SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2085 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQCV 232 S+H EY + + LLC +L Y + S++ F G + + CV Sbjct: 2001 SNHAEYVVYRQNVVRSRLLCATLLSVVYSVSLDSRYNELFTGRSLQSCV 2049 >SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 150 SNHAEYVVYRQNVVRSRVLCATLLPVVYSISLDSRYNELFTGRSLQSC 197 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 1206 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYYELFTGRSLQSC 1253 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + +LC +LP Y + S++ F G + + C Sbjct: 413 SNHAEYVVYRQNVVRPRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 460 >SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) Length = 783 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + +LC +LP Y + S++ F G + + C Sbjct: 504 SNHAEYVVYRQNVVRTRVLCATLLPVVYSVSLDSRYNELFTGHSLQSC 551 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 378 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFR*FFQGATFEQC 235 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 786 SNHAEYVVYRQNVVRSGVLCATLLPVVYSLSLDSRYNELFTGRSLQSC 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,461,945 Number of Sequences: 59808 Number of extensions: 534950 Number of successful extensions: 1507 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1505 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -