BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0808 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 3.3 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 24 5.8 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 5.8 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 743 HYCFTAEIGRAVVPTRADSQEVLP 672 H F AEIG ++V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -3 Query: 127 IGFCISTINIRKAEPDLHILANRRISYNYYER 32 +GFCIS + + P H+ R + + + R Sbjct: 531 LGFCISRVKMAPPTPKEHLRCYRCLEHGHNAR 562 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 206 LHDLCMYVLYVRAWNQQIL 150 L L + Y+ AWNQQIL Sbjct: 206 LEQLDLSYNYISAWNQQIL 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 763,816 Number of Sequences: 2352 Number of extensions: 14786 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -