BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0807 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.4 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 4.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.6 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.9 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.9 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.9 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 9.9 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 317 CFCRFAVSVLIFYTLGGNTQGREWNTWSAAIIYPL 213 C+C +++S+ TLG W WS IY L Sbjct: 554 CYCYYSISIRPISTLG-------WFFWSLLRIYEL 581 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 531 FSQRALRAAXTSCPKHQPTP 472 F+ AA TS P H P P Sbjct: 146 FAASIFHAAATSLPLHYPPP 165 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 483 DASDKMXKQLSKLAGRRERTPNMMI 557 +ASDK + ++ RE+ P++ I Sbjct: 568 EASDKDPEMYDRVVALREKNPDLKI 592 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 20.6 bits (41), Expect = 9.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 476 HHFXPFIHQHHG 441 +++ P +H HHG Sbjct: 83 NYYHPQLHSHHG 94 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 20.6 bits (41), Expect = 9.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 476 HHFXPFIHQHHG 441 +++ P +H HHG Sbjct: 83 NYYHPQLHSHHG 94 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 20.6 bits (41), Expect = 9.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 476 HHFXPFIHQHHG 441 +++ P +H HHG Sbjct: 83 NYYHPQLHSHHG 94 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 20.6 bits (41), Expect = 9.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 476 HHFXPFIHQHHG 441 +++ P +H HHG Sbjct: 83 NYYHPQLHSHHG 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,321 Number of Sequences: 336 Number of extensions: 2662 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -