BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0807 (574 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 1.6 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.8 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.8 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.8 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 5.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 5.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 6.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 6.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 6.6 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 6.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.6 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 8.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.7 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 278 CKRSVR*RQSGKNMEQVHRR**SKNAELQRLLDRSLEEQRLQ 403 CKR S +N + ++ R SKN + ++ +++ E +R Q Sbjct: 38 CKRVYSSLNSLRNHKSIYHRQHSKNEQQRKEMEQMREREREQ 79 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 124 IHKKFYRDRSNTENYTNNEW 65 IH Y+ N NY NN + Sbjct: 89 IHNNNYKYNYNNNNYNNNNY 108 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 124 IHKKFYRDRSNTENYTNNEW 65 IH Y+ N NY NN + Sbjct: 89 IHNNNYKYNYNNNNYNNNNY 108 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 487 ASTDTTLXPSFTSIMESIPVPQA 419 A+ TT+ P F + S+P+P A Sbjct: 461 ATVGTTVAPCFEEPLPSLPLPGA 483 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.8 bits (44), Expect = 5.0 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +2 Query: 26 LPIFLCHKY 52 +P F+CHKY Sbjct: 49 VPTFMCHKY 57 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -2 Query: 135 SIFKFIKSFIETGATRKIIRTTNG 64 ++F+FI+ + +G+T K+ NG Sbjct: 330 NLFEFIRKQVLSGSTGKVAFDDNG 353 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 224 LWQRTRYSTRVLGYSLRGCK 283 +W+ T ST LG+ + G K Sbjct: 401 VWRETISSTATLGFRVEGIK 420 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 224 LWQRTRYSTRVLGYSLRGCK 283 +W+ T ST LG+ + G K Sbjct: 316 VWRETISSTATLGFRVEGIK 335 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 224 LWQRTRYSTRVLGYSLRGCK 283 +W+ T ST LG+ + G K Sbjct: 635 VWRETISSTATLGFRVEGIK 654 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 109 YRDRSNTENYTNNEWLFYII 50 Y + +N NY N + L+Y I Sbjct: 94 YNNYNNNNNYNNYKKLYYNI 113 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -3 Query: 371 EVFVVLRSLITISDELVPCFCRFAVSVLIFY 279 E+ + R + + + ++PC +V++L+FY Sbjct: 206 EIRLRRRPMFYVFNLILPCILINSVALLVFY 236 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 436 IPVPQAASRTVLQPL 392 +PVPQ T+L P+ Sbjct: 796 VPVPQVNDSTILSPV 810 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -1 Query: 439 SIPVPQAASRTVLQPLFFKRPIKKSL 362 +IPVPQAA++ ++ ++P + L Sbjct: 55 TIPVPQAANKGMINQYGGEQPTLRLL 80 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 49 ILCKIAIRCSYNFPCCSGLYKTFYEFKY*KVRVIDEVPIMSIVDC 183 I+ ++ +YN LY Y+ Y + I+++PI + C Sbjct: 81 IISSLSNNYNYNNNNYKKLYCNNYKKLYYNINYIEQIPIPVPIYC 125 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 49 ILCKIAIRCSYNFPCCSGLYKTFYEFKY*KVRVIDEVPIMSIVDC 183 I+ ++ +YN LY Y+ Y + I+++PI + C Sbjct: 81 IISSLSNNYNYNNNNYKKLYCNNYKKLYYNINYIEQIPIPVPIYC 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,148 Number of Sequences: 438 Number of extensions: 3385 Number of successful extensions: 25 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -